Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BSO20_RS16690 Genome accession   NZ_CP018200
Coordinates   3408187..3408327 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain WS-8     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3403187..3413327
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSO20_RS16660 (BSO20_16670) - 3403490..3403888 (+) 399 WP_003152031.1 YueI family protein -
  BSO20_RS16665 (BSO20_16675) - 3403985..3404536 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  BSO20_RS16670 (BSO20_16680) - 3404554..3406020 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BSO20_RS16675 (BSO20_16685) - 3406150..3407373 (+) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  BSO20_RS16680 (BSO20_16690) - 3407380..3407721 (-) 342 WP_032876795.1 hypothetical protein -
  BSO20_RS16690 (BSO20_16700) degQ 3408187..3408327 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BSO20_RS16695 (BSO20_16705) - 3408535..3409395 (+) 861 WP_142925231.1 polyprenyl synthetase family protein -
  BSO20_RS19485 comX 3409364..3409537 (+) 174 WP_012118314.1 competence pheromone ComX -
  BSO20_RS16705 (BSO20_16715) - 3409551..3411851 (+) 2301 Protein_3248 histidine kinase -
  BSO20_RS16710 (BSO20_16720) comA 3411932..3412576 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  BSO20_RS16715 (BSO20_16725) - 3412598..3412981 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=207154 BSO20_RS16690 WP_003152043.1 3408187..3408327(+) (degQ) [Bacillus amyloliquefaciens strain WS-8]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=207154 BSO20_RS16690 WP_003152043.1 3408187..3408327(+) (degQ) [Bacillus amyloliquefaciens strain WS-8]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment