Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BSF20_RS11645 Genome accession   NZ_CP018152
Coordinates   2238183..2238323 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain LM2303     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2233183..2243323
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSF20_RS11620 (BSF20_11380) - 2233489..2233887 (+) 399 WP_003152031.1 YueI family protein -
  BSF20_RS11625 (BSF20_11385) - 2233984..2234535 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  BSF20_RS11630 (BSF20_11390) - 2234553..2236019 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  BSF20_RS11635 (BSF20_11395) - 2236149..2237369 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  BSF20_RS11640 (BSF20_11400) - 2237376..2237717 (-) 342 WP_014305721.1 hypothetical protein -
  BSF20_RS11645 (BSF20_11405) degQ 2238183..2238323 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BSF20_RS11650 (BSF20_11410) - 2238475..2239350 (+) 876 WP_026092320.1 polyprenyl synthetase family protein -
  BSF20_RS11655 (BSF20_11415) comX 2239365..2239541 (+) 177 WP_044052947.1 competence pheromone ComX -
  BSF20_RS11660 (BSF20_11420) - 2239560..2241856 (+) 2297 Protein_2246 histidine kinase -
  BSF20_RS11665 (BSF20_11425) comA 2241937..2242581 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  BSF20_RS11670 (BSF20_11430) - 2242603..2242986 (+) 384 WP_044052949.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=206531 BSF20_RS11645 WP_003152043.1 2238183..2238323(+) (degQ) [Bacillus amyloliquefaciens strain LM2303]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=206531 BSF20_RS11645 WP_003152043.1 2238183..2238323(+) (degQ) [Bacillus amyloliquefaciens strain LM2303]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment