Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BSF20_RS05010 Genome accession   NZ_CP018152
Coordinates   949106..949225 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain LM2303     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 944106..954225
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSF20_RS04980 (BSF20_04895) - 944345..945103 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  BSF20_RS04985 (BSF20_04900) - 945097..946044 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  BSF20_RS04990 (BSF20_04905) ceuB 946034..946987 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  BSF20_RS05000 (BSF20_04910) - 947402..948766 (+) 1365 WP_072588301.1 aspartate kinase -
  BSF20_RS05005 - 948846..948956 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  BSF20_RS05010 (BSF20_04915) phrC 949106..949225 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BSF20_RS05015 (BSF20_04920) rapC 949209..950357 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  BSF20_RS05020 (BSF20_04925) - 950510..951943 (-) 1434 WP_161625271.1 sensor histidine kinase -
  BSF20_RS05025 (BSF20_04930) - 951930..952613 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=206508 BSF20_RS05010 WP_003156334.1 949106..949225(-) (phrC) [Bacillus amyloliquefaciens strain LM2303]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=206508 BSF20_RS05010 WP_003156334.1 949106..949225(-) (phrC) [Bacillus amyloliquefaciens strain LM2303]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment