Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BRL64_RS14995 Genome accession   NZ_CP018100
Coordinates   2859641..2859781 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain BRM1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2854641..2864781
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BRL64_RS14970 (BRL64_14715) - 2854974..2855363 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  BRL64_RS14975 (BRL64_14720) comA 2855387..2856028 (-) 642 WP_034282566.1 response regulator transcription factor Regulator
  BRL64_RS14980 (BRL64_14725) comP 2856109..2858400 (-) 2292 WP_065215229.1 ATP-binding protein Regulator
  BRL64_RS14985 (BRL64_14730) comX 2858414..2858587 (-) 174 WP_046313343.1 competence pheromone ComX -
  BRL64_RS14990 (BRL64_14735) - 2858565..2859488 (-) 924 WP_065215228.1 polyprenyl synthetase family protein -
  BRL64_RS14995 (BRL64_14740) degQ 2859641..2859781 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  BRL64_RS15000 (BRL64_14745) - 2860287..2860643 (+) 357 WP_041115816.1 hypothetical protein -
  BRL64_RS15005 (BRL64_14750) - 2860679..2861905 (-) 1227 WP_024423326.1 EAL and HDOD domain-containing protein -
  BRL64_RS15010 (BRL64_14755) - 2862043..2863515 (-) 1473 WP_046313339.1 nicotinate phosphoribosyltransferase -
  BRL64_RS15015 (BRL64_14760) - 2863533..2864084 (-) 552 WP_024425949.1 cysteine hydrolase family protein -
  BRL64_RS15020 (BRL64_14765) - 2864145..2864552 (-) 408 WP_034282575.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=205783 BRL64_RS14995 WP_003213123.1 2859641..2859781(-) (degQ) [Bacillus safensis strain BRM1]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=205783 BRL64_RS14995 WP_003213123.1 2859641..2859781(-) (degQ) [Bacillus safensis strain BRM1]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment