Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BLL65_RS07440 Genome accession   NZ_CP018007
Coordinates   1429048..1429221 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain sx01604     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1424048..1434221
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BLL65_RS07390 (BLL65_07260) comGD 1424167..1424604 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BLL65_RS07395 (BLL65_07265) comGE 1424588..1424902 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  BLL65_RS07400 (BLL65_07270) comGF 1424811..1425311 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  BLL65_RS07405 (BLL65_07275) comGG 1425312..1425689 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  BLL65_RS07410 (BLL65_07280) - 1425746..1425925 (+) 180 WP_022552966.1 YqzE family protein -
  BLL65_RS07415 (BLL65_07285) - 1425966..1426295 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  BLL65_RS07420 (BLL65_07290) tapA 1426554..1427225 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  BLL65_RS07425 (BLL65_07295) sipW 1427197..1427781 (+) 585 WP_032874025.1 signal peptidase I SipW -
  BLL65_RS07430 (BLL65_07300) tasA 1427846..1428631 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  BLL65_RS07435 (BLL65_07305) sinR 1428679..1429014 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BLL65_RS07440 (BLL65_07310) sinI 1429048..1429221 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  BLL65_RS07445 (BLL65_07315) - 1429398..1430192 (-) 795 WP_007612541.1 YqhG family protein -
  BLL65_RS07450 (BLL65_07320) - 1430214..1431884 (-) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  BLL65_RS07455 (BLL65_07325) gcvT 1432307..1433407 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=204995 BLL65_RS07440 WP_032874029.1 1429048..1429221(-) (sinI) [Bacillus velezensis strain sx01604]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=204995 BLL65_RS07440 WP_032874029.1 1429048..1429221(-) (sinI) [Bacillus velezensis strain sx01604]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment