Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   BLL65_RS07405 Genome accession   NZ_CP018007
Coordinates   1425312..1425689 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain sx01604     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1420312..1430689
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BLL65_RS07370 (BLL65_07240) - 1420623..1421573 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  BLL65_RS07375 (BLL65_07245) comGA 1421770..1422840 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  BLL65_RS07380 (BLL65_07250) comGB 1422827..1423864 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  BLL65_RS07385 (BLL65_07255) comGC 1423869..1424177 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  BLL65_RS07390 (BLL65_07260) comGD 1424167..1424604 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  BLL65_RS07395 (BLL65_07265) comGE 1424588..1424902 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  BLL65_RS07400 (BLL65_07270) comGF 1424811..1425311 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  BLL65_RS07405 (BLL65_07275) comGG 1425312..1425689 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  BLL65_RS07410 (BLL65_07280) - 1425746..1425925 (+) 180 WP_022552966.1 YqzE family protein -
  BLL65_RS07415 (BLL65_07285) - 1425966..1426295 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  BLL65_RS07420 (BLL65_07290) tapA 1426554..1427225 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  BLL65_RS07425 (BLL65_07295) sipW 1427197..1427781 (+) 585 WP_032874025.1 signal peptidase I SipW -
  BLL65_RS07430 (BLL65_07300) tasA 1427846..1428631 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  BLL65_RS07435 (BLL65_07305) sinR 1428679..1429014 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BLL65_RS07440 (BLL65_07310) sinI 1429048..1429221 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  BLL65_RS07445 (BLL65_07315) - 1429398..1430192 (-) 795 WP_007612541.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=204993 BLL65_RS07405 WP_032874019.1 1425312..1425689(+) (comGG) [Bacillus velezensis strain sx01604]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=204993 BLL65_RS07405 WP_032874019.1 1425312..1425689(+) (comGG) [Bacillus velezensis strain sx01604]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment