Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BAMY_RS12170 | Genome accession | NZ_CP017953 |
| Coordinates | 2487829..2488002 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain Y14 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2482829..2493002
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAMY_RS12155 (BAMY_11890) | gcvT | 2483647..2484747 (-) | 1101 | WP_003153108.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BAMY_RS12160 (BAMY_11895) | - | 2485170..2486840 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| BAMY_RS12165 (BAMY_11900) | - | 2486858..2487652 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| BAMY_RS12170 (BAMY_11905) | sinI | 2487829..2488002 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BAMY_RS12175 (BAMY_11910) | sinR | 2488036..2488371 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BAMY_RS12180 (BAMY_11915) | tasA | 2488419..2489204 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| BAMY_RS12185 (BAMY_11920) | sipW | 2489268..2489852 (-) | 585 | WP_025852917.1 | signal peptidase I SipW | - |
| BAMY_RS12190 (BAMY_11925) | tapA | 2489824..2490495 (-) | 672 | WP_025852919.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BAMY_RS12195 (BAMY_11930) | - | 2490754..2491083 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| BAMY_RS12200 (BAMY_11935) | - | 2491123..2491302 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BAMY_RS12205 (BAMY_11940) | comGG | 2491359..2491736 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BAMY_RS12210 (BAMY_11945) | comGF | 2491737..2492237 (-) | 501 | WP_226565836.1 | competence type IV pilus minor pilin ComGF | - |
| BAMY_RS12215 (BAMY_11950) | comGE | 2492146..2492460 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BAMY_RS12220 (BAMY_11955) | comGD | 2492444..2492881 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=204402 BAMY_RS12170 WP_003153105.1 2487829..2488002(+) (sinI) [Bacillus amyloliquefaciens strain Y14]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=204402 BAMY_RS12170 WP_003153105.1 2487829..2488002(+) (sinI) [Bacillus amyloliquefaciens strain Y14]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |