Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BAMY_RS01965 Genome accession   NZ_CP017953
Coordinates   381724..381843 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus amyloliquefaciens strain Y14     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 376724..386843
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMY_RS01950 (BAMY_01910) - 378336..379019 (+) 684 WP_003156341.1 response regulator transcription factor -
  BAMY_RS01955 (BAMY_01915) - 379006..380439 (+) 1434 WP_162130794.1 sensor histidine kinase -
  BAMY_RS01960 (BAMY_01920) rapC 380592..381740 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  BAMY_RS01965 (BAMY_01925) phrC 381724..381843 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BAMY_RS01970 - 381993..382103 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  BAMY_RS01975 (BAMY_01930) - 382183..383547 (-) 1365 WP_003156333.1 aspartate kinase -
  BAMY_RS01985 (BAMY_01935) ceuB 383962..384915 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  BAMY_RS01990 (BAMY_01940) - 384905..385852 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  BAMY_RS01995 (BAMY_01945) - 385846..386604 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=204372 BAMY_RS01965 WP_003156334.1 381724..381843(+) (phrC) [Bacillus amyloliquefaciens strain Y14]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=204372 BAMY_RS01965 WP_003156334.1 381724..381843(+) (phrC) [Bacillus amyloliquefaciens strain Y14]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment