Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   SPG_0489 Genome accession   CP001015
Coordinates   479741..479890 (+) Length   49 a.a.
NCBI ID   ACF55862.1    Uniprot ID   -
Organism   Streptococcus pneumoniae G54     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 474741..484890
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPG_0481 blpPQ 476358..476561 (+) 204 ACF55901.1 bacteriocin blpPQ -
  SPG_0482 - 476879..477082 (+) 204 ACF56382.1 hypothetical protein -
  SPG_0483 - 477656..477820 (+) 165 ACF55779.1 conserved hypothetical protein -
  SPG_0484 - 478116..478487 (+) 372 ACF56124.1 IS1381, transposase OrfA -
  SPG_0485 - 478575..478874 (+) 300 ACF56729.1 IS1381, transposase OrfB -
  SPG_0486 blpM 479024..479278 (+) 255 ACF54924.1 bacteriocin BlpM -
  SPG_0487 blpN 479294..479497 (+) 204 ACF55518.1 bacteriocin BlpN -
  SPG_0488 - 479516..479725 (+) 210 ACF56807.1 bacteriocin blp -
  SPG_0489 cipB 479741..479890 (+) 150 ACF55862.1 bacteriocin BlpO Regulator
  SPG_0490 - 479872..479991 (+) 120 ACF55302.1 conserved hypothetical protein -
  SPG_0491 - 479994..480113 (+) 120 ACF56056.1 conserved hypothetical protein -
  SPG_0492 blpX 480899..481282 (+) 384 ACF55471.1 immunity protein BlpX -
  SPG_0493 - 481334..482023 (+) 690 ACF55006.1 immunity protein BlpY -
  SPG_0494 blpZ 482065..482313 (+) 249 ACF56447.1 BlpZ protein, fusion -
  SPG_0495 - 482343..482954 (+) 612 ACF55940.1 CAAX amino terminal protease family -
  SPG_0496 - 483115..483909 (+) 795 ACF56126.1 Phosphotransferase enzyme family protein -
  SPG_0497 trmB 483906..484541 (+) 636 ACF55826.1 tRNA (guanine-N(7)-)-methyltransferase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=20337 SPG_0489 ACF55862.1 479741..479890(+) (cipB) [Streptococcus pneumoniae G54]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=20337 SPG_0489 ACF55862.1 479741..479890(+) (cipB) [Streptococcus pneumoniae G54]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment