Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   CJZ70_RS04480 Genome accession   NZ_CP022890
Coordinates   872717..872857 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain DKU_NT_02     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 867717..877857
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJZ70_RS04455 (CJZ70_04455) yueI 868011..868409 (+) 399 WP_014480710.1 YueI family protein -
  CJZ70_RS04460 (CJZ70_04460) pncA 868506..869057 (+) 552 WP_095010585.1 isochorismatase family cysteine hydrolase -
  CJZ70_RS04465 (CJZ70_04465) pncB 869073..870545 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  CJZ70_RS04470 (CJZ70_04470) pdeH 870682..871911 (+) 1230 WP_095010586.1 cyclic di-GMP phosphodiesterase -
  CJZ70_RS04475 (CJZ70_04475) - 871887..872255 (-) 369 WP_017695529.1 hypothetical protein -
  CJZ70_RS21085 - 872370..872495 (-) 126 WP_120028613.1 hypothetical protein -
  CJZ70_RS04480 (CJZ70_04480) degQ 872717..872857 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  CJZ70_RS04485 (CJZ70_04485) comQ 873041..873904 (+) 864 WP_095010814.1 polyprenyl synthetase family protein Regulator
  CJZ70_RS04490 (CJZ70_04490) comX 873906..874127 (+) 222 WP_014480704.1 competence pheromone ComX -
  CJZ70_RS04495 (CJZ70_04495) comP 874143..876455 (+) 2313 WP_014480703.1 sensor histidine kinase Regulator
  CJZ70_RS04500 (CJZ70_04500) comA 876536..877180 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  CJZ70_RS04505 (CJZ70_04505) yuxO 877199..877579 (+) 381 WP_069837723.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=202789 CJZ70_RS04480 WP_003220708.1 872717..872857(+) (degQ) [Bacillus subtilis strain DKU_NT_02]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=202789 CJZ70_RS04480 WP_003220708.1 872717..872857(+) (degQ) [Bacillus subtilis strain DKU_NT_02]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1