Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BK055_RS01965 Genome accession   NZ_CP017775
Coordinates   393048..393167 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain 9912D     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 388048..398167
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BK055_RS01950 (BK055_01950) - 389660..390343 (+) 684 WP_014416901.1 response regulator transcription factor -
  BK055_RS01955 (BK055_01955) - 390330..391757 (+) 1428 WP_088056326.1 sensor histidine kinase -
  BK055_RS01960 (BK055_01960) rapC 391916..393064 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  BK055_RS01965 (BK055_01965) phrC 393048..393167 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BK055_RS01970 (BK055_01970) - 393317..393427 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  BK055_RS01975 (BK055_01975) - 393507..394871 (-) 1365 WP_025649998.1 aspartate kinase -
  BK055_RS01980 (BK055_01980) ceuB 395285..396238 (+) 954 WP_013351008.1 ABC transporter permease Machinery gene
  BK055_RS01985 (BK055_01985) - 396228..397175 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  BK055_RS01990 (BK055_01990) - 397169..397927 (+) 759 WP_071181530.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=202784 BK055_RS01965 WP_003156334.1 393048..393167(+) (phrC) [Bacillus velezensis strain 9912D]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=202784 BK055_RS01965 WP_003156334.1 393048..393167(+) (phrC) [Bacillus velezensis strain 9912D]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment