Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BI197_RS03825 Genome accession   NZ_CP017747
Coordinates   752222..752395 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SYBC H47     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 747222..757395
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BI197_RS03775 comGD 747343..747780 (+) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  BI197_RS03780 comGE 747764..748078 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  BI197_RS03785 comGF 747987..748487 (+) 501 WP_230014462.1 competence type IV pilus minor pilin ComGF -
  BI197_RS03790 comGG 748488..748865 (+) 378 WP_071391611.1 competence type IV pilus minor pilin ComGG Machinery gene
  BI197_RS03795 - 748922..749101 (+) 180 WP_003153093.1 YqzE family protein -
  BI197_RS03800 - 749141..749470 (-) 330 WP_071391612.1 DUF3889 domain-containing protein -
  BI197_RS03805 tapA 749729..750400 (+) 672 WP_071391613.1 amyloid fiber anchoring/assembly protein TapA -
  BI197_RS03810 sipW 750372..750956 (+) 585 WP_060562614.1 signal peptidase I SipW -
  BI197_RS03815 tasA 751020..751805 (+) 786 WP_071391614.1 biofilm matrix protein TasA -
  BI197_RS03820 sinR 751853..752188 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BI197_RS03825 sinI 752222..752395 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  BI197_RS03830 - 752572..753366 (-) 795 WP_071391615.1 YqhG family protein -
  BI197_RS03835 - 753384..755054 (-) 1671 WP_071391616.1 DEAD/DEAH box helicase -
  BI197_RS03840 gcvT 755478..756578 (+) 1101 WP_071391617.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=202434 BI197_RS03825 WP_003153105.1 752222..752395(-) (sinI) [Bacillus velezensis strain SYBC H47]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=202434 BI197_RS03825 WP_003153105.1 752222..752395(-) (sinI) [Bacillus velezensis strain SYBC H47]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment