Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BI197_RS03825 | Genome accession | NZ_CP017747 |
| Coordinates | 752222..752395 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SYBC H47 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 747222..757395
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BI197_RS03775 | comGD | 747343..747780 (+) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| BI197_RS03780 | comGE | 747764..748078 (+) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BI197_RS03785 | comGF | 747987..748487 (+) | 501 | WP_230014462.1 | competence type IV pilus minor pilin ComGF | - |
| BI197_RS03790 | comGG | 748488..748865 (+) | 378 | WP_071391611.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BI197_RS03795 | - | 748922..749101 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| BI197_RS03800 | - | 749141..749470 (-) | 330 | WP_071391612.1 | DUF3889 domain-containing protein | - |
| BI197_RS03805 | tapA | 749729..750400 (+) | 672 | WP_071391613.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BI197_RS03810 | sipW | 750372..750956 (+) | 585 | WP_060562614.1 | signal peptidase I SipW | - |
| BI197_RS03815 | tasA | 751020..751805 (+) | 786 | WP_071391614.1 | biofilm matrix protein TasA | - |
| BI197_RS03820 | sinR | 751853..752188 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BI197_RS03825 | sinI | 752222..752395 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BI197_RS03830 | - | 752572..753366 (-) | 795 | WP_071391615.1 | YqhG family protein | - |
| BI197_RS03835 | - | 753384..755054 (-) | 1671 | WP_071391616.1 | DEAD/DEAH box helicase | - |
| BI197_RS03840 | gcvT | 755478..756578 (+) | 1101 | WP_071391617.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=202434 BI197_RS03825 WP_003153105.1 752222..752395(-) (sinI) [Bacillus velezensis strain SYBC H47]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=202434 BI197_RS03825 WP_003153105.1 752222..752395(-) (sinI) [Bacillus velezensis strain SYBC H47]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |