Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   BI197_RS03780 Genome accession   NZ_CP017747
Coordinates   747764..748078 (+) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain SYBC H47     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 742764..753078
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BI197_RS03755 - 743805..744755 (+) 951 WP_071391609.1 magnesium transporter CorA family protein -
  BI197_RS03760 comGA 744946..746016 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  BI197_RS03765 comGB 746003..747040 (+) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  BI197_RS03770 comGC 747045..747353 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  BI197_RS03775 comGD 747343..747780 (+) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  BI197_RS03780 comGE 747764..748078 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  BI197_RS03785 comGF 747987..748487 (+) 501 WP_230014462.1 competence type IV pilus minor pilin ComGF -
  BI197_RS03790 comGG 748488..748865 (+) 378 WP_071391611.1 competence type IV pilus minor pilin ComGG Machinery gene
  BI197_RS03795 - 748922..749101 (+) 180 WP_003153093.1 YqzE family protein -
  BI197_RS03800 - 749141..749470 (-) 330 WP_071391612.1 DUF3889 domain-containing protein -
  BI197_RS03805 tapA 749729..750400 (+) 672 WP_071391613.1 amyloid fiber anchoring/assembly protein TapA -
  BI197_RS03810 sipW 750372..750956 (+) 585 WP_060562614.1 signal peptidase I SipW -
  BI197_RS03815 tasA 751020..751805 (+) 786 WP_071391614.1 biofilm matrix protein TasA -
  BI197_RS03820 sinR 751853..752188 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BI197_RS03825 sinI 752222..752395 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=202431 BI197_RS03780 WP_015388003.1 747764..748078(+) (comGE) [Bacillus velezensis strain SYBC H47]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=202431 BI197_RS03780 WP_015388003.1 747764..748078(+) (comGE) [Bacillus velezensis strain SYBC H47]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment