Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   CG450_RS04695 Genome accession   NZ_CP022477
Coordinates   952137..952277 (+) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   A0ABM6LMF9
Organism   Bacillus licheniformis strain BL-010     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 947137..957277
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CG450_RS04665 - 947238..947639 (+) 402 WP_003184870.1 YueI family protein -
  CG450_RS04670 - 947824..948375 (+) 552 WP_003184868.1 cysteine hydrolase family protein -
  CG450_RS04675 - 948393..949862 (+) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  CG450_RS04680 - 950041..951261 (+) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  CG450_RS04685 - 951304..951651 (-) 348 WP_009329512.1 hypothetical protein -
  CG450_RS04695 degQ 952137..952277 (+) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  CG450_RS04700 comQ 952466..953335 (+) 870 WP_011198252.1 polyprenyl synthetase family protein Regulator
  CG450_RS04705 comX 953350..953514 (+) 165 WP_011198251.1 competence pheromone ComX -
  CG450_RS04710 comP 953554..955875 (+) 2322 WP_026080865.1 ATP-binding protein Regulator
  CG450_RS04715 comA 955962..956600 (+) 639 WP_003184849.1 response regulator transcription factor Regulator
  CG450_RS04720 - 956617..957006 (+) 390 WP_003184847.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=200951 CG450_RS04695 WP_003184860.1 952137..952277(+) (degQ) [Bacillus licheniformis strain BL-010]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=200951 CG450_RS04695 WP_003184860.1 952137..952277(+) (degQ) [Bacillus licheniformis strain BL-010]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment