Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | CG450_RS04695 | Genome accession | NZ_CP022477 |
| Coordinates | 952137..952277 (+) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain BL-010 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 947137..957277
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CG450_RS04665 | - | 947238..947639 (+) | 402 | WP_003184870.1 | YueI family protein | - |
| CG450_RS04670 | - | 947824..948375 (+) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| CG450_RS04675 | - | 948393..949862 (+) | 1470 | WP_003184866.1 | nicotinate phosphoribosyltransferase | - |
| CG450_RS04680 | - | 950041..951261 (+) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| CG450_RS04685 | - | 951304..951651 (-) | 348 | WP_009329512.1 | hypothetical protein | - |
| CG450_RS04695 | degQ | 952137..952277 (+) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| CG450_RS04700 | comQ | 952466..953335 (+) | 870 | WP_011198252.1 | polyprenyl synthetase family protein | Regulator |
| CG450_RS04705 | comX | 953350..953514 (+) | 165 | WP_011198251.1 | competence pheromone ComX | - |
| CG450_RS04710 | comP | 953554..955875 (+) | 2322 | WP_026080865.1 | ATP-binding protein | Regulator |
| CG450_RS04715 | comA | 955962..956600 (+) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| CG450_RS04720 | - | 956617..957006 (+) | 390 | WP_003184847.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=200951 CG450_RS04695 WP_003184860.1 952137..952277(+) (degQ) [Bacillus licheniformis strain BL-010]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=200951 CG450_RS04695 WP_003184860.1 952137..952277(+) (degQ) [Bacillus licheniformis strain BL-010]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |