Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BS16045_RS16880 Genome accession   NZ_CP017112
Coordinates   3203849..3203989 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain BS16045     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3198849..3208989
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BS16045_RS16855 (BS16045_03336) yuxO 3199199..3199579 (-) 381 WP_069322860.1 hotdog fold thioesterase -
  BS16045_RS16860 (BS16045_03337) comA 3199598..3200242 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BS16045_RS16865 (BS16045_03338) comP 3200323..3202620 (-) 2298 WP_033884760.1 histidine kinase Regulator
  BS16045_RS16870 (BS16045_03339) comX 3202628..3202789 (-) 162 WP_003228803.1 competence pheromone ComX -
  BS16045_RS16875 (BS16045_03340) - 3202804..3203664 (-) 861 WP_069322861.1 polyprenyl synthetase family protein -
  BS16045_RS16880 (BS16045_03341) degQ 3203849..3203989 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BS16045_RS22490 - 3204211..3204336 (+) 126 WP_003228793.1 hypothetical protein -
  BS16045_RS16885 (BS16045_03342) - 3204450..3204818 (+) 369 WP_014477834.1 hypothetical protein -
  BS16045_RS16890 (BS16045_03343) pdeH 3204794..3206023 (-) 1230 WP_069322862.1 cyclic di-GMP phosphodiesterase -
  BS16045_RS16895 (BS16045_03344) pncB 3206160..3207632 (-) 1473 WP_019712928.1 nicotinate phosphoribosyltransferase -
  BS16045_RS16900 (BS16045_03345) pncA 3207648..3208199 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  BS16045_RS16905 (BS16045_03346) yueI 3208296..3208694 (-) 399 WP_019712929.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=195723 BS16045_RS16880 WP_003220708.1 3203849..3203989(-) (degQ) [Bacillus subtilis strain BS16045]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=195723 BS16045_RS16880 WP_003220708.1 3203849..3203989(-) (degQ) [Bacillus subtilis strain BS16045]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment