Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BGM23_RS09790 Genome accession   NZ_CP017072
Coordinates   1860361..1860534 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. FJAT-14266     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1855361..1865534
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BGM23_RS09745 (BGM23_09745) comGE 1855711..1856058 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  BGM23_RS09750 (BGM23_09750) comGF 1856084..1856467 (+) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  BGM23_RS09755 (BGM23_09755) comGG 1856468..1856842 (+) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  BGM23_RS09760 (BGM23_09760) - 1856914..1857093 (+) 180 WP_029726723.1 YqzE family protein -
  BGM23_RS09765 (BGM23_09765) - 1857135..1857461 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  BGM23_RS09770 (BGM23_09770) tapA 1857733..1858494 (+) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  BGM23_RS09775 (BGM23_09775) - 1858478..1859050 (+) 573 WP_072692741.1 signal peptidase I -
  BGM23_RS09780 (BGM23_09780) tasA 1859114..1859899 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  BGM23_RS09785 (BGM23_09785) sinR 1859992..1860327 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BGM23_RS09790 (BGM23_09790) sinI 1860361..1860534 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  BGM23_RS09795 (BGM23_09795) - 1860717..1861511 (-) 795 WP_015714249.1 YqhG family protein -
  BGM23_RS09800 (BGM23_09800) - 1861532..1863205 (-) 1674 WP_029726726.1 SNF2-related protein -
  BGM23_RS09805 (BGM23_09805) gcvT 1863646..1864734 (+) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=195191 BGM23_RS09790 WP_003230187.1 1860361..1860534(-) (sinI) [Bacillus sp. FJAT-14266]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=195191 BGM23_RS09790 WP_003230187.1 1860361..1860534(-) (sinI) [Bacillus sp. FJAT-14266]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment