Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BGM23_RS05885 Genome accession   NZ_CP017072
Coordinates   1142010..1142150 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FJAT-14266     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1137010..1147150
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BGM23_RS05860 (BGM23_05860) - 1137305..1137703 (+) 399 WP_015251331.1 YueI family protein -
  BGM23_RS05865 (BGM23_05865) - 1137800..1138351 (+) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  BGM23_RS05870 (BGM23_05870) - 1138367..1139839 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BGM23_RS05875 (BGM23_05875) pdeH 1139976..1141205 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BGM23_RS05880 (BGM23_05880) - 1141181..1141549 (-) 369 WP_014477834.1 hypothetical protein -
  BGM23_RS21755 - 1141663..1141788 (-) 126 WP_003228793.1 hypothetical protein -
  BGM23_RS05885 (BGM23_05885) degQ 1142010..1142150 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BGM23_RS05890 (BGM23_05890) - 1142335..1143198 (+) 864 WP_032722437.1 polyprenyl synthetase family protein -
  BGM23_RS05895 (BGM23_05895) comX 1143200..1143421 (+) 222 WP_014480704.1 competence pheromone ComX -
  BGM23_RS05900 (BGM23_05900) comP 1143437..1145749 (+) 2313 WP_032722435.1 histidine kinase Regulator
  BGM23_RS05905 (BGM23_05905) comA 1145830..1146474 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BGM23_RS05910 (BGM23_05910) - 1146493..1146873 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=195167 BGM23_RS05885 WP_003220708.1 1142010..1142150(+) (degQ) [Bacillus sp. FJAT-14266]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=195167 BGM23_RS05885 WP_003220708.1 1142010..1142150(+) (degQ) [Bacillus sp. FJAT-14266]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment