Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   S100141_RS14305 Genome accession   NZ_CP021669
Coordinates   2646470..2646610 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   A0ABM6LMF9
Organism   Bacillus licheniformis strain SRCM100141     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2641470..2651610
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S100141_RS14280 (S100141_02890) - 2641790..2642179 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  S100141_RS14285 (S100141_02891) comA 2642196..2642834 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  S100141_RS14290 (S100141_02892) comP 2642921..2645221 (-) 2301 WP_009329509.1 ATP-binding protein Regulator
  S100141_RS14295 (S100141_02893) comX 2645223..2645396 (-) 174 WP_009329510.1 competence pheromone ComX -
  S100141_RS14300 (S100141_02894) comQ 2645400..2646281 (-) 882 WP_009329511.1 polyprenyl synthetase family protein Regulator
  S100141_RS14305 (S100141_02895) degQ 2646470..2646610 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  S100141_RS14315 (S100141_02897) - 2647096..2647443 (+) 348 WP_009329512.1 hypothetical protein -
  S100141_RS14320 (S100141_02898) - 2647486..2648706 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  S100141_RS14325 (S100141_02899) - 2648885..2650294 (-) 1410 WP_228767691.1 nicotinate phosphoribosyltransferase -
  S100141_RS14330 (S100141_02900) - 2650372..2650923 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  S100141_RS14335 (S100141_02901) - 2651108..2651509 (-) 402 WP_003184870.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=194643 S100141_RS14305 WP_003184860.1 2646470..2646610(-) (degQ) [Bacillus licheniformis strain SRCM100141]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=194643 S100141_RS14305 WP_003184860.1 2646470..2646610(-) (degQ) [Bacillus licheniformis strain SRCM100141]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment