Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | S100141_RS14305 | Genome accession | NZ_CP021669 |
| Coordinates | 2646470..2646610 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain SRCM100141 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2641470..2651610
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| S100141_RS14280 (S100141_02890) | - | 2641790..2642179 (-) | 390 | WP_009329508.1 | hotdog fold thioesterase | - |
| S100141_RS14285 (S100141_02891) | comA | 2642196..2642834 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| S100141_RS14290 (S100141_02892) | comP | 2642921..2645221 (-) | 2301 | WP_009329509.1 | ATP-binding protein | Regulator |
| S100141_RS14295 (S100141_02893) | comX | 2645223..2645396 (-) | 174 | WP_009329510.1 | competence pheromone ComX | - |
| S100141_RS14300 (S100141_02894) | comQ | 2645400..2646281 (-) | 882 | WP_009329511.1 | polyprenyl synthetase family protein | Regulator |
| S100141_RS14305 (S100141_02895) | degQ | 2646470..2646610 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| S100141_RS14315 (S100141_02897) | - | 2647096..2647443 (+) | 348 | WP_009329512.1 | hypothetical protein | - |
| S100141_RS14320 (S100141_02898) | - | 2647486..2648706 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| S100141_RS14325 (S100141_02899) | - | 2648885..2650294 (-) | 1410 | WP_228767691.1 | nicotinate phosphoribosyltransferase | - |
| S100141_RS14330 (S100141_02900) | - | 2650372..2650923 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| S100141_RS14335 (S100141_02901) | - | 2651108..2651509 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=194643 S100141_RS14305 WP_003184860.1 2646470..2646610(-) (degQ) [Bacillus licheniformis strain SRCM100141]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=194643 S100141_RS14305 WP_003184860.1 2646470..2646610(-) (degQ) [Bacillus licheniformis strain SRCM100141]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |