Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BARD7_RS10940 | Genome accession | NZ_CP016913 |
| Coordinates | 2250284..2250457 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens strain RD7-7 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2245284..2255457
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BARD7_RS10925 (BARD7_02242) | gcvT | 2246095..2247195 (-) | 1101 | WP_065981873.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BARD7_RS10930 (BARD7_02243) | - | 2247619..2249289 (+) | 1671 | WP_065981874.1 | DEAD/DEAH box helicase | - |
| BARD7_RS10935 (BARD7_02244) | - | 2249310..2250104 (+) | 795 | WP_065981875.1 | YqhG family protein | - |
| BARD7_RS10940 (BARD7_02245) | sinI | 2250284..2250457 (+) | 174 | WP_013352860.1 | anti-repressor SinI | Regulator |
| BARD7_RS10945 (BARD7_02246) | sinR | 2250491..2250826 (+) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| BARD7_RS10950 (BARD7_02247) | tasA | 2250874..2251659 (-) | 786 | WP_065981876.1 | biofilm matrix protein TasA | - |
| BARD7_RS10955 (BARD7_02248) | sipW | 2251724..2252308 (-) | 585 | WP_065981877.1 | signal peptidase I SipW | - |
| BARD7_RS10960 (BARD7_02249) | tapA | 2252280..2252951 (-) | 672 | WP_065981878.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BARD7_RS10965 (BARD7_02250) | - | 2253209..2253538 (+) | 330 | WP_045510605.1 | DUF3889 domain-containing protein | - |
| BARD7_RS10970 (BARD7_02251) | - | 2253579..2253758 (-) | 180 | WP_016938971.1 | YqzE family protein | - |
| BARD7_RS10975 (BARD7_02252) | comGG | 2253815..2254192 (-) | 378 | WP_065981879.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BARD7_RS10980 | comGF | 2254194..2254694 (-) | 501 | WP_231131085.1 | competence type IV pilus minor pilin ComGF | - |
| BARD7_RS10985 (BARD7_02254) | comGE | 2254603..2254917 (-) | 315 | WP_065981881.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BARD7_RS10990 (BARD7_02255) | comGD | 2254901..2255338 (-) | 438 | WP_065981882.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=193628 BARD7_RS10940 WP_013352860.1 2250284..2250457(+) (sinI) [Bacillus amyloliquefaciens strain RD7-7]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=193628 BARD7_RS10940 WP_013352860.1 2250284..2250457(+) (sinI) [Bacillus amyloliquefaciens strain RD7-7]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |