Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BSHJ0_RS13350 Genome accession   NZ_CP016894
Coordinates   2547980..2548363 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain HJ0-6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2542980..2553363
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSHJ0_RS13310 (BSHJ0_02618) sinI 2543914..2544087 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BSHJ0_RS13315 (BSHJ0_02619) sinR 2544121..2544456 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSHJ0_RS13320 (BSHJ0_02620) tasA 2544549..2545334 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  BSHJ0_RS13325 (BSHJ0_02621) sipW 2545398..2545970 (-) 573 WP_072692741.1 signal peptidase I SipW -
  BSHJ0_RS13330 (BSHJ0_02622) tapA 2545954..2546715 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  BSHJ0_RS13335 (BSHJ0_02623) yqzG 2546986..2547312 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSHJ0_RS13340 (BSHJ0_02624) spoIITA 2547354..2547533 (-) 180 WP_029726723.1 YqzE family protein -
  BSHJ0_RS13345 (BSHJ0_02625) comGG 2547605..2547979 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  BSHJ0_RS13350 (BSHJ0_02626) comGF 2547980..2548363 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  BSHJ0_RS13355 (BSHJ0_02627) comGE 2548389..2548736 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  BSHJ0_RS13360 (BSHJ0_02628) comGD 2548720..2549151 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  BSHJ0_RS13365 (BSHJ0_02629) comGC 2549141..2549437 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  BSHJ0_RS13370 (BSHJ0_02630) comGB 2549451..2550488 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  BSHJ0_RS13375 (BSHJ0_02631) comGA 2550475..2551545 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BSHJ0_RS13385 (BSHJ0_02633) - 2551758..2551955 (-) 198 WP_029726717.1 hypothetical protein -
  BSHJ0_RS13390 (BSHJ0_02634) corA 2551957..2552910 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=193452 BSHJ0_RS13350 WP_029726721.1 2547980..2548363(-) (comGF) [Bacillus subtilis strain HJ0-6]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=193452 BSHJ0_RS13350 WP_029726721.1 2547980..2548363(-) (comGF) [Bacillus subtilis strain HJ0-6]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment