Detailed information NTG0191838

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: QP84_RS14635
• Genome accession: NZ_CP016684
• Coordinates: 1206053..1206175 (-)
• Length: 40 a.a.
• NCBI ID: WP_306807940.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain L91543
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1201053..1211175

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QP84_RS06200 (QP84_006200)	pilC	1203060..1206056 (-)	2997	WP_065818661.1	PilC family type IV pilus tip adhesin	Machinery gene
QP84_RS14635	pilC	1206053..1206175 (-)	123	WP_306807940.1	hypothetical protein	Machinery gene
QP84_RS06205 (QP84_006205)	apbC	1207129..1208208 (-)	1080	WP_042745125.1	iron-sulfur cluster carrier protein ApbC	-
QP84_RS06215 (QP84_006215)	-	1208573..1209082 (+)	510	WP_002240006.1	protein disulfide oxidoreductase	-
QP84_RS06225 (QP84_006225)	nadR	1209425..1209865 (+)	441	WP_002221507.1	MarR family adhesin repressor NadR	-
QP84_RS06230 (QP84_006230)	hpaC	1209980..1210480 (+)	501	WP_021439402.1	4-hydroxyphenylacetate 3-monooxygenase, reductase component	-

Sequence

Protein

• Length: 40 a.a.
• Molecular weight: 4556.43 Da
• Isoelectric Point: 12.8111

>NTDB_id=191838 QP84_RS14635 WP_306807940.1 1206053..1206175(-) (pilC) [Neisseria meningitidis strain L91543]
MNKTLKRRVFRHTALYAAILMFSHTGGGGRRRKPVNTLLS

Nucleotide

• Length: 123 bp

>NTDB_id=191838 QP84_RS14635 WP_306807940.1 1206053..1206175(-) (pilC) [Neisseria meningitidis strain L91543]
ATGAATAAAACTTTAAAAAGGCGGGTTTTCCGCCATACCGCGCTTTATGCCGCCATCTTGATGTTTTCCCATACCGGCGG
GGGGGGGCGCAGGCGCAAACCCGTCAATACGCTATTATCATGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	96.552	72.5	0.7