Detailed information NTG0191747

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: A6L58_RS14910
• Genome accession: NZ_CP016682
• Coordinates: 52855..52977 (+)
• Length: 40 a.a.
• NCBI ID: WP_306807940.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain M24705
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 47855..57977

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A6L58_RS00200 (A6L58_00200)	hpaC	48224..48724 (-)	501	WP_002233027.1	4-hydroxyphenylacetate 3-monooxygenase, reductase component	-
A6L58_RS00205 (A6L58_00205)	nadR	48839..49279 (-)	441	WP_002221507.1	MarR family adhesin repressor NadR	-
A6L58_RS00215 (A6L58_00215)	-	49622..50131 (-)	510	WP_002240006.1	protein disulfide oxidoreductase	-
A6L58_RS00225 (A6L58_00225)	apbC	50496..51575 (+)	1080	WP_002239302.1	iron-sulfur cluster carrier protein ApbC	-
A6L58_RS14910	pilC	52855..52977 (+)	123	WP_306807940.1	hypothetical protein	Machinery gene
A6L58_RS00230 (A6L58_00230)	pilC	52974..55943 (+)	2970	WP_025464225.1	PilC family type IV pilus tip adhesin	Machinery gene

Sequence

Protein

• Length: 40 a.a.
• Molecular weight: 4556.43 Da
• Isoelectric Point: 12.8111

>NTDB_id=191747 A6L58_RS14910 WP_306807940.1 52855..52977(+) (pilC) [Neisseria meningitidis strain M24705]
MNKTLKRRVFRHTALYAAILMFSHTGGGGRRRKPVNTLLS

Nucleotide

• Length: 123 bp

>NTDB_id=191747 A6L58_RS14910 WP_306807940.1 52855..52977(+) (pilC) [Neisseria meningitidis strain M24705]
ATGAATAAAACTTTAAAAAGGCGGGTTTTCCGCCATACCGCGCTTTATGCCGCCATCTTGATGTTTTCCCATACCGGCGG
GGGGGGGCGCAGGCGCAAACCCGTCAATACGCTATTATCATGA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	96.552	72.5	0.7