Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   CAH07_RS08930 Genome accession   NZ_CP021123
Coordinates   1689398..1689571 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SEM-9     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1684398..1694571
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CAH07_RS08885 (CAH07_08770) comGE 1684749..1685096 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  CAH07_RS08890 (CAH07_08775) comGF 1685122..1685505 (+) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  CAH07_RS08895 (CAH07_08780) comGG 1685506..1685880 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  CAH07_RS08900 (CAH07_08785) spoIITA 1685951..1686130 (+) 180 WP_003230176.1 YqzE family protein -
  CAH07_RS08905 (CAH07_08790) yqzG 1686172..1686498 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  CAH07_RS08910 (CAH07_08795) tapA 1686770..1687531 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  CAH07_RS08915 (CAH07_08800) sipW 1687515..1688087 (+) 573 WP_003246088.1 signal peptidase I SipW -
  CAH07_RS08920 (CAH07_08805) tasA 1688151..1688936 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  CAH07_RS08925 (CAH07_08810) sinR 1689029..1689364 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CAH07_RS08930 (CAH07_08815) sinI 1689398..1689571 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  CAH07_RS08935 (CAH07_08820) yqhG 1689754..1690548 (-) 795 WP_003230200.1 YqhG family protein -
  CAH07_RS08940 (CAH07_08825) hepAA 1690569..1692242 (-) 1674 WP_004398544.1 SNF2-related protein -
  CAH07_RS08945 (CAH07_08830) gcvT 1692684..1693772 (+) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=190533 CAH07_RS08930 WP_003230187.1 1689398..1689571(-) (sinI) [Bacillus subtilis strain SEM-9]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=190533 CAH07_RS08930 WP_003230187.1 1689398..1689571(-) (sinI) [Bacillus subtilis strain SEM-9]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1