Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   CAH07_RS08890 Genome accession   NZ_CP021123
Coordinates   1685122..1685505 (+) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis strain SEM-9     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1680122..1690505
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CAH07_RS08855 (CAH07_08740) corA 1680575..1681528 (+) 954 WP_029317911.1 magnesium transporter CorA -
  CAH07_RS08865 (CAH07_08750) comGA 1681940..1683010 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  CAH07_RS08870 (CAH07_08755) comGB 1682997..1684034 (+) 1038 WP_101172386.1 comG operon protein ComGB Machinery gene
  CAH07_RS08875 (CAH07_08760) comGC 1684048..1684344 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  CAH07_RS08880 (CAH07_08765) comGD 1684334..1684765 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  CAH07_RS08885 (CAH07_08770) comGE 1684749..1685096 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  CAH07_RS08890 (CAH07_08775) comGF 1685122..1685505 (+) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  CAH07_RS08895 (CAH07_08780) comGG 1685506..1685880 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  CAH07_RS08900 (CAH07_08785) spoIITA 1685951..1686130 (+) 180 WP_003230176.1 YqzE family protein -
  CAH07_RS08905 (CAH07_08790) yqzG 1686172..1686498 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  CAH07_RS08910 (CAH07_08795) tapA 1686770..1687531 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  CAH07_RS08915 (CAH07_08800) sipW 1687515..1688087 (+) 573 WP_003246088.1 signal peptidase I SipW -
  CAH07_RS08920 (CAH07_08805) tasA 1688151..1688936 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  CAH07_RS08925 (CAH07_08810) sinR 1689029..1689364 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  CAH07_RS08930 (CAH07_08815) sinI 1689398..1689571 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=190530 CAH07_RS08890 WP_015251713.1 1685122..1685505(+) (comGF) [Bacillus subtilis strain SEM-9]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=190530 CAH07_RS08890 WP_015251713.1 1685122..1685505(+) (comGF) [Bacillus subtilis strain SEM-9]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment