Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   B9L64_RS04625 Genome accession   NZ_CP020915
Coordinates   942446..942829 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain 50-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 937446..947829
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B9L64_RS04585 sinI 938379..938552 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  B9L64_RS04590 sinR 938586..938921 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  B9L64_RS04595 tasA 939014..939799 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  B9L64_RS04600 sipW 939863..940435 (-) 573 WP_072692741.1 signal peptidase I SipW -
  B9L64_RS04605 tapA 940419..941180 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  B9L64_RS04610 yqzG 941452..941778 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  B9L64_RS04615 spoIITA 941820..941999 (-) 180 WP_029726723.1 YqzE family protein -
  B9L64_RS04620 comGG 942071..942445 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  B9L64_RS04625 comGF 942446..942829 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  B9L64_RS04630 comGE 942855..943202 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  B9L64_RS04635 comGD 943186..943617 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  B9L64_RS04640 comGC 943607..943903 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  B9L64_RS04645 comGB 943917..944954 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  B9L64_RS04650 comGA 944941..946011 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  B9L64_RS04655 - 946224..946421 (-) 198 WP_029726717.1 hypothetical protein -
  B9L64_RS04660 corA 946423..947376 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=189765 B9L64_RS04625 WP_029726721.1 942446..942829(-) (comGF) [Bacillus subtilis strain 50-1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=189765 B9L64_RS04625 WP_029726721.1 942446..942829(-) (comGF) [Bacillus subtilis strain 50-1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment