Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   A4W80_RS04020 Genome accession   NZ_CP016470
Coordinates   781695..782003 (+) Length   102 a.a.
NCBI ID   WP_004270901.1    Uniprot ID   A0AAJ0LFY3
Organism   Latilactobacillus curvatus strain TMW 1.595     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 776695..787003
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A4W80_RS03980 (A4W80_03960) - 776977..777216 (-) 240 WP_076786750.1 cytochrome b5 domain-containing protein -
  A4W80_RS03985 (A4W80_03965) - 777411..777746 (+) 336 WP_076786752.1 hypothetical protein -
  A4W80_RS03995 (A4W80_03975) - 777927..778304 (-) 378 WP_076786754.1 hypothetical protein -
  A4W80_RS04000 (A4W80_03980) - 778407..778907 (+) 501 WP_004270893.1 VanZ family protein -
  A4W80_RS04005 (A4W80_03985) - 778997..779728 (+) 732 WP_004270897.1 YebC/PmpR family DNA-binding transcriptional regulator -
  A4W80_RS04010 (A4W80_03990) comGA 779832..780707 (+) 876 WP_076786756.1 competence type IV pilus ATPase ComGA Machinery gene
  A4W80_RS04015 (A4W80_03995) comGB 780697..781698 (+) 1002 WP_076786758.1 type II secretion system F family protein Machinery gene
  A4W80_RS04020 (A4W80_04000) comGC 781695..782003 (+) 309 WP_004270901.1 competence type IV pilus major pilin ComGC Machinery gene
  A4W80_RS04025 (A4W80_04005) - 782035..782427 (+) 393 WP_004270899.1 hypothetical protein -
  A4W80_RS04030 (A4W80_04010) - 782492..782719 (+) 228 WP_158070299.1 hypothetical protein -
  A4W80_RS10665 - 782685..782768 (+) 84 Protein_775 type II secretion system protein -
  A4W80_RS04035 (A4W80_04015) - 782790..783170 (+) 381 WP_004270914.1 ComGF family competence protein -
  A4W80_RS04040 (A4W80_04020) - 783148..783471 (+) 324 WP_039099486.1 hypothetical protein -
  A4W80_RS04045 - 783596..784216 (+) 621 WP_253733291.1 hypothetical protein -
  A4W80_RS04050 - 784108..784605 (+) 498 WP_253733292.1 class I SAM-dependent methyltransferase -
  A4W80_RS04055 (A4W80_04030) - 784627..785820 (+) 1194 WP_039099488.1 acetate/propionate family kinase -
  A4W80_RS04060 (A4W80_04035) - 785880..786332 (+) 453 WP_076786762.1 laaL -

Sequence

Protein


Download         Length: 102 a.a.        Molecular weight: 11238.13 Da        Isoelectric Point: 9.6264

>NTDB_id=188474 A4W80_RS04020 WP_004270901.1 781695..782003(+) (comGC) [Latilactobacillus curvatus strain TMW 1.595]
MKKKRNAFTLIEMVVVLAVIAMLVLLIAPNLMHQKETAEQKTDTALVATIQTQVELAEDDGKTVSSLADLASGEKYLTNN
QVKQAEKRGITIKDNKVVQNTK

Nucleotide


Download         Length: 309 bp        

>NTDB_id=188474 A4W80_RS04020 WP_004270901.1 781695..782003(+) (comGC) [Latilactobacillus curvatus strain TMW 1.595]
ATGAAGAAGAAAAGAAATGCATTTACATTGATCGAAATGGTCGTTGTGCTAGCTGTGATAGCAATGTTAGTCTTGTTAAT
TGCACCTAATTTAATGCATCAGAAAGAGACAGCTGAGCAAAAAACGGATACGGCTCTAGTGGCAACGATTCAAACACAAG
TTGAATTAGCTGAGGATGACGGTAAAACGGTGTCGAGTCTAGCCGATTTAGCATCAGGTGAAAAATATTTAACCAATAAT
CAGGTTAAACAAGCTGAAAAACGCGGCATAACAATTAAGGATAATAAAGTTGTTCAAAATACAAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(2-27)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

60

98.039

0.588

Multiple sequence alignment