Detailed information    

insolico Bioinformatically predicted

Overview


Name   amiD   Type   Regulator
Locus tag   BAY21_RS07590 Genome accession   NZ_CP016439
Coordinates   1425404..1426330 (+) Length   308 a.a.
NCBI ID   WP_002946409.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain CS8     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1372109..1443880 1425404..1426330 within 0


Gene organization within MGE regions


Location: 1372109..1443880
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAY21_RS07340 (BAY21_07340) - 1372207..1372947 (-) 741 WP_002945131.1 amino acid ABC transporter ATP-binding protein -
  BAY21_RS07345 (BAY21_07345) - 1372947..1375157 (-) 2211 WP_011226350.1 ABC transporter substrate-binding protein/permease -
  BAY21_RS11450 - 1375356..1376292 (+) 937 Protein_1385 CPBP family intramembrane glutamic endopeptidase -
  BAY21_RS07365 (BAY21_07365) uvrB 1376979..1378970 (+) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  BAY21_RS07370 (BAY21_07370) - 1379015..1379479 (+) 465 WP_011226345.1 8-oxo-dGTP diphosphatase -
  BAY21_RS07375 (BAY21_07375) - 1379693..1380523 (+) 831 WP_041828297.1 transporter substrate-binding domain-containing protein -
  BAY21_RS07380 (BAY21_07380) - 1380520..1381317 (+) 798 WP_059257394.1 transporter substrate-binding domain-containing protein -
  BAY21_RS07385 (BAY21_07385) - 1381664..1382773 (+) 1110 WP_041827078.1 aminotransferase -
  BAY21_RS07390 (BAY21_07390) - 1382866..1383660 (+) 795 WP_011227442.1 ABC transporter substrate-binding protein -
  BAY21_RS07395 (BAY21_07395) - 1383766..1384719 (-) 954 WP_041826943.1 IS30 family transposase -
  BAY21_RS07400 (BAY21_07400) rpsU 1385100..1385276 (+) 177 WP_011226340.1 30S ribosomal protein S21 -
  BAY21_RS07405 (BAY21_07405) dnaG 1385648..1387459 (+) 1812 WP_011227441.1 DNA primase -
  BAY21_RS07410 (BAY21_07410) rpoD 1387463..1388572 (+) 1110 WP_011227440.1 RNA polymerase sigma factor RpoD -
  BAY21_RS07415 (BAY21_07415) - 1388626..1388961 (+) 336 WP_002891474.1 metal-sulfur cluster assembly factor -
  BAY21_RS07420 (BAY21_07420) - 1388971..1389897 (+) 927 WP_011227439.1 glycosyltransferase family 2 protein -
  BAY21_RS07425 (BAY21_07425) rfbD 1390015..1390866 (+) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  BAY21_RS07430 (BAY21_07430) - 1390987..1392246 (+) 1260 WP_011227438.1 oligosaccharide flippase family protein -
  BAY21_RS07435 (BAY21_07435) - 1392243..1393229 (+) 987 WP_011227437.1 glycosyltransferase family 2 protein -
  BAY21_RS07440 (BAY21_07440) - 1393294..1393766 (+) 473 Protein_1401 glycosyltransferase family 2 protein -
  BAY21_RS07445 (BAY21_07445) - 1393850..1394545 (+) 696 WP_173405413.1 glycosyltransferase family 2 protein -
  BAY21_RS07450 (BAY21_07450) - 1394551..1394883 (+) 333 WP_011227433.1 DUF2304 domain-containing protein -
  BAY21_RS07455 (BAY21_07455) - 1394884..1395666 (+) 783 WP_011227432.1 glycosyltransferase family A protein -
  BAY21_RS07460 (BAY21_07460) cps2T 1395785..1396933 (+) 1149 WP_011227431.1 beta 1-4 rhamnosyltransferase Cps2T -
  BAY21_RS07465 (BAY21_07465) - 1396930..1397871 (+) 942 WP_011227430.1 glycosyltransferase family 2 protein -
  BAY21_RS07470 (BAY21_07470) - 1397871..1398677 (+) 807 WP_011227429.1 ABC transporter permease -
  BAY21_RS07475 (BAY21_07475) - 1398677..1399879 (+) 1203 WP_011227428.1 ABC transporter ATP-binding protein -
  BAY21_RS07480 (BAY21_07480) - 1399897..1401597 (+) 1701 WP_041827077.1 glycosyltransferase family 4 protein -
  BAY21_RS07485 (BAY21_07485) - 1401599..1403344 (+) 1746 WP_011227426.1 rhamnan synthesis F family protein -
  BAY21_RS07490 (BAY21_07490) - 1403493..1404833 (+) 1341 WP_231108743.1 DUF2142 domain-containing protein -
  BAY21_RS07495 (BAY21_07495) radC 1405012..1405698 (+) 687 WP_011227424.1 RadC family protein -
  BAY21_RS07500 (BAY21_07500) - 1405751..1406446 (-) 696 WP_011227423.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  BAY21_RS07505 (BAY21_07505) - 1406439..1407098 (-) 660 WP_041827076.1 redox-sensing transcriptional repressor Rex -
  BAY21_RS07510 (BAY21_07510) - 1407242..1407589 (-) 348 WP_002948028.1 DUF1831 domain-containing protein -
  BAY21_RS10410 (BAY21_07515) - 1407591..1408703 (-) 1113 WP_002948029.1 cysteine desulfurase family protein -
  BAY21_RS10415 (BAY21_07520) - 1408707..1409678 (-) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  BAY21_RS07525 (BAY21_07525) - 1410041..1410616 (-) 576 WP_002951444.1 CYTH domain-containing protein -
  BAY21_RS07530 (BAY21_07530) - 1410712..1411386 (+) 675 WP_002951443.1 GTP pyrophosphokinase -
  BAY21_RS07535 (BAY21_07535) - 1411358..1412194 (+) 837 WP_041827075.1 NAD kinase -
  BAY21_RS07540 (BAY21_07540) - 1412191..1413087 (+) 897 WP_011226316.1 RluA family pseudouridine synthase -
  BAY21_RS07545 (BAY21_07545) pta 1413101..1414084 (+) 984 WP_011227420.1 phosphate acetyltransferase -
  BAY21_RS10020 - 1414170..1415522 (+) 1353 Protein_1423 IS3 family transposase -
  BAY21_RS07560 (BAY21_07560) - 1415568..1416773 (-) 1206 WP_011227415.1 OFA family MFS transporter -
  BAY21_RS07565 (BAY21_07565) - 1417122..1417436 (+) 315 Protein_1425 TatD family hydrolase -
  BAY21_RS11180 - 1417468..1417878 (+) 411 Protein_1426 ATP-binding cassette domain-containing protein -
  BAY21_RS10030 - 1417872..1418062 (+) 191 Protein_1427 IS3 family transposase -
  BAY21_RS07575 (BAY21_07575) amiA3 1418266..1420233 (+) 1968 WP_011227411.1 peptide ABC transporter substrate-binding protein Regulator
  BAY21_RS10035 - 1420278..1421527 (-) 1250 Protein_1429 ISL3 family transposase -
  BAY21_RS07580 (BAY21_07580) - 1421883..1423849 (+) 1967 Protein_1430 peptide ABC transporter substrate-binding protein -
  BAY21_RS07585 (BAY21_07585) amiC 1423911..1425404 (+) 1494 WP_011227407.1 ABC transporter permease Regulator
  BAY21_RS07590 (BAY21_07590) amiD 1425404..1426330 (+) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  BAY21_RS07595 (BAY21_07595) amiE 1426340..1427425 (+) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  BAY21_RS07600 (BAY21_07600) amiF 1427418..1428347 (+) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  BAY21_RS07605 (BAY21_07605) - 1428397..1429182 (-) 786 WP_002951425.1 hypothetical protein -
  BAY21_RS07610 (BAY21_07610) - 1429194..1429892 (-) 699 WP_011226301.1 ABC transporter ATP-binding protein -
  BAY21_RS07615 (BAY21_07615) - 1429897..1430274 (-) 378 WP_011226300.1 GntR family transcriptional regulator -
  BAY21_RS07620 (BAY21_07620) - 1430457..1431251 (+) 795 WP_011227406.1 HAD hydrolase family protein -
  BAY21_RS07625 (BAY21_07625) - 1431244..1432059 (+) 816 WP_011227405.1 Cof-type HAD-IIB family hydrolase -
  BAY21_RS07630 (BAY21_07630) ftsY 1432073..1433464 (+) 1392 WP_011226297.1 signal recognition particle-docking protein FtsY -
  BAY21_RS07635 (BAY21_07635) gmk 1433697..1434326 (+) 630 WP_011226296.1 guanylate kinase -
  BAY21_RS07640 (BAY21_07640) rpoZ 1434348..1434662 (+) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  BAY21_RS07645 (BAY21_07645) - 1434804..1437200 (+) 2397 WP_011227404.1 primosomal protein N' -
  BAY21_RS07650 (BAY21_07650) fmt 1437218..1438153 (+) 936 WP_002951411.1 methionyl-tRNA formyltransferase -
  BAY21_RS07655 (BAY21_07655) rsmB 1438143..1439464 (+) 1322 Protein_1445 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  BAY21_RS07660 (BAY21_07660) - 1439508..1440245 (+) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  BAY21_RS07665 (BAY21_07665) stkP/pknB 1440245..1442116 (+) 1872 WP_011226292.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  BAY21_RS11185 - 1442753..1442908 (+) 156 WP_011226290.1 ion channel -
  BAY21_RS07670 (BAY21_07670) liaF 1443174..1443872 (+) 699 WP_011227403.1 cell wall-active antibiotics response protein LiaF -

Sequence


Protein


Download         Length: 308 a.a.        Molecular weight: 34694.85 Da        Isoelectric Point: 9.7054

>NTDB_id=188271 BAY21_RS07590 WP_002946409.1 1425404..1426330(+) (amiD) [Streptococcus thermophilus strain CS8]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR

Nucleotide


Download         Length: 927 bp        

>NTDB_id=188271 BAY21_RS07590 WP_002946409.1 1425404..1426330(+) (amiD) [Streptococcus thermophilus strain CS8]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiD Streptococcus thermophilus LMG 18311

100

100

1

  amiD Streptococcus thermophilus LMD-9

100

100

1

  amiD Streptococcus salivarius strain HSISS4

96.429

100

0.964


Multiple sequence alignment