Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BBJ33_RS15020 Genome accession   NZ_CP016395
Coordinates   3101770..3101910 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain M75     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3096770..3106910
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BBJ33_RS14995 (BBJ33_14995) - 3097067..3097450 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  BBJ33_RS15000 (BBJ33_15000) comA 3097472..3098116 (-) 645 WP_069473558.1 response regulator transcription factor Regulator
  BBJ33_RS15005 (BBJ33_15005) comP 3098197..3100500 (-) 2304 WP_069473559.1 histidine kinase Regulator
  BBJ33_RS15010 (BBJ33_15010) comX 3100520..3100699 (-) 180 WP_306383677.1 competence pheromone ComX -
  BBJ33_RS15015 (BBJ33_15015) comQ 3100653..3101639 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  BBJ33_RS15020 (BBJ33_15020) degQ 3101770..3101910 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BBJ33_RS15025 (BBJ33_15025) - 3102376..3102717 (+) 342 WP_003152040.1 hypothetical protein -
  BBJ33_RS15030 (BBJ33_15030) - 3102724..3103944 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  BBJ33_RS15035 (BBJ33_15035) - 3104074..3105540 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  BBJ33_RS15040 (BBJ33_15040) - 3105558..3106109 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  BBJ33_RS15045 (BBJ33_15045) - 3106206..3106604 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=187934 BBJ33_RS15020 WP_003152043.1 3101770..3101910(-) (degQ) [Bacillus velezensis strain M75]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=187934 BBJ33_RS15020 WP_003152043.1 3101770..3101910(-) (degQ) [Bacillus velezensis strain M75]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment