Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   A5891_RS11375 Genome accession   NZ_CP016371
Coordinates   2435790..2435963 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain S3-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2430790..2440963
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A5891_RS11360 (A5891_11360) gcvT 2431604..2432704 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  A5891_RS11365 (A5891_11365) - 2433127..2434797 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  A5891_RS11370 (A5891_11370) - 2434819..2435613 (+) 795 WP_007612541.1 YqhG family protein -
  A5891_RS11375 (A5891_11375) sinI 2435790..2435963 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  A5891_RS11380 (A5891_11380) sinR 2435997..2436332 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  A5891_RS11385 (A5891_11385) tasA 2436380..2437165 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  A5891_RS11390 (A5891_11390) sipW 2437230..2437814 (-) 585 WP_032874025.1 signal peptidase I SipW -
  A5891_RS11395 (A5891_11395) tapA 2437786..2438457 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  A5891_RS11400 (A5891_11400) - 2438716..2439045 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  A5891_RS11405 (A5891_11405) - 2439086..2439265 (-) 180 WP_022552966.1 YqzE family protein -
  A5891_RS11410 (A5891_11410) comGG 2439322..2439699 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  A5891_RS11415 (A5891_11415) comGF 2439700..2440200 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  A5891_RS11420 (A5891_11420) comGE 2440109..2440423 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  A5891_RS11425 (A5891_11425) comGD 2440407..2440844 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=187479 A5891_RS11375 WP_032874029.1 2435790..2435963(+) (sinI) [Bacillus velezensis strain S3-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=187479 A5891_RS11375 WP_032874029.1 2435790..2435963(+) (sinI) [Bacillus velezensis strain S3-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment