Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   A5891_RS11420 Genome accession   NZ_CP016371
Coordinates   2440109..2440423 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain S3-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2435109..2445423
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A5891_RS11375 (A5891_11375) sinI 2435790..2435963 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  A5891_RS11380 (A5891_11380) sinR 2435997..2436332 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  A5891_RS11385 (A5891_11385) tasA 2436380..2437165 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  A5891_RS11390 (A5891_11390) sipW 2437230..2437814 (-) 585 WP_032874025.1 signal peptidase I SipW -
  A5891_RS11395 (A5891_11395) tapA 2437786..2438457 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  A5891_RS11400 (A5891_11400) - 2438716..2439045 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  A5891_RS11405 (A5891_11405) - 2439086..2439265 (-) 180 WP_022552966.1 YqzE family protein -
  A5891_RS11410 (A5891_11410) comGG 2439322..2439699 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  A5891_RS11415 (A5891_11415) comGF 2439700..2440200 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  A5891_RS11420 (A5891_11420) comGE 2440109..2440423 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  A5891_RS11425 (A5891_11425) comGD 2440407..2440844 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  A5891_RS11430 (A5891_11430) comGC 2440834..2441142 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  A5891_RS11435 (A5891_11435) comGB 2441147..2442184 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  A5891_RS11440 (A5891_11440) comGA 2442171..2443241 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  A5891_RS11445 (A5891_11445) - 2443438..2444388 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=187482 A5891_RS11420 WP_032874016.1 2440109..2440423(-) (comGE) [Bacillus velezensis strain S3-1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=187482 A5891_RS11420 WP_032874016.1 2440109..2440423(-) (comGE) [Bacillus velezensis strain S3-1]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment