Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilN   Type   Machinery gene
Locus tag   BBB50_RS01635 Genome accession   NZ_CP016324
Coordinates   311987..312571 (+) Length   194 a.a.
NCBI ID   WP_000902745.1    Uniprot ID   A0A0H6BVQ2
Organism   Vibrio cholerae 2740-80     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 277611..315403 311987..312571 within 0


Gene organization within MGE regions


Location: 277611..315403
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BBB50_RS01355 (BBB50_01355) - 277611..278147 (-) 537 WP_001065600.1 hypothetical protein -
  BBB50_RS01360 (BBB50_01360) - 278147..278998 (-) 852 WP_001895339.1 hypothetical protein -
  BBB50_RS01365 (BBB50_01365) - 278998..279585 (-) 588 WP_000510163.1 YmfQ family protein -
  BBB50_RS01370 (BBB50_01370) - 279570..280637 (-) 1068 WP_001147110.1 baseplate J/gp47 family protein -
  BBB50_RS01375 (BBB50_01375) - 280627..281076 (-) 450 WP_000095018.1 phage GP46 family protein -
  BBB50_RS01380 (BBB50_01380) - 281079..281696 (-) 618 WP_170826454.1 phage baseplate assembly protein V -
  BBB50_RS01385 (BBB50_01385) - 281690..282769 (-) 1080 WP_001286435.1 phage baseplate assembly protein -
  BBB50_RS01390 (BBB50_01390) - 282762..284081 (-) 1320 WP_000863380.1 DNA circularization protein -
  BBB50_RS19195 - 284093..285796 (-) 1704 WP_001284562.1 tape measure protein -
  BBB50_RS01405 (BBB50_01405) - 285922..286281 (-) 360 WP_000996598.1 phage tail assembly protein -
  BBB50_RS01410 (BBB50_01410) - 286281..286634 (-) 354 WP_001895328.1 phage tail tube protein -
  BBB50_RS01415 (BBB50_01415) - 286649..288133 (-) 1485 WP_001128141.1 phage tail sheath subtilisin-like domain-containing protein -
  BBB50_RS01420 (BBB50_01420) - 288136..288336 (-) 201 WP_000437435.1 DUF2635 domain-containing protein -
  BBB50_RS01425 (BBB50_01425) - 288350..288949 (-) 600 WP_000100991.1 hypothetical protein -
  BBB50_RS01430 (BBB50_01430) - 288946..289488 (-) 543 WP_000513061.1 phage virion morphogenesis protein -
  BBB50_RS01435 (BBB50_01435) - 289488..289922 (-) 435 WP_001029276.1 gp436 family protein -
  BBB50_RS01440 (BBB50_01440) - 289928..290503 (-) 576 WP_000004756.1 hypothetical protein -
  BBB50_RS01445 (BBB50_01445) - 290592..291491 (-) 900 WP_001218331.1 Mu-like prophage major head subunit gpT family protein -
  BBB50_RS01450 (BBB50_01450) - 291494..292450 (-) 957 WP_001262460.1 phage protease -
  BBB50_RS01455 (BBB50_01455) - 292783..293067 (-) 285 WP_001249579.1 hypothetical protein -
  BBB50_RS01460 (BBB50_01460) - 293067..293702 (-) 636 WP_000638762.1 hypothetical protein -
  BBB50_RS01465 (BBB50_01465) - 293699..294211 (-) 513 WP_000638754.1 tail needle knob protein -
  BBB50_RS01470 (BBB50_01470) - 294208..294456 (-) 249 WP_000246042.1 hypothetical protein -
  BBB50_RS01475 (BBB50_01475) - 294468..295250 (-) 783 WP_412034587.1 phage minor head protein -
  BBB50_RS01480 (BBB50_01480) - 295234..296793 (-) 1560 WP_000027033.1 DUF935 domain-containing protein -
  BBB50_RS01485 (BBB50_01485) - 296790..298355 (-) 1566 WP_001105344.1 terminase family protein -
  BBB50_RS01490 (BBB50_01490) - 298356..298922 (-) 567 WP_001195537.1 DUF3486 family protein -
  BBB50_RS01495 (BBB50_01495) - 298934..299224 (-) 291 WP_000008606.1 hypothetical protein -
  BBB50_RS01500 (BBB50_01500) - 299233..299532 (-) 300 WP_000362983.1 DUF2730 family protein -
  BBB50_RS01505 (BBB50_01505) - 299532..299762 (-) 231 WP_001281317.1 TraR/DksA C4-type zinc finger protein -
  BBB50_RS01510 (BBB50_01510) - 299759..300358 (-) 600 WP_001120998.1 hypothetical protein -
  BBB50_RS21080 (BBB50_01515) - 300334..300621 (-) 288 WP_000828640.1 hypothetical protein -
  BBB50_RS01520 (BBB50_01520) - 300621..301178 (-) 558 WP_000493682.1 glycoside hydrolase family 108 protein -
  BBB50_RS01525 (BBB50_01525) - 301263..301679 (-) 417 WP_001029055.1 Mor transcription activator family protein -
  BBB50_RS01530 (BBB50_01530) - 301758..302204 (-) 447 WP_000837433.1 hypothetical protein -
  BBB50_RS01535 (BBB50_01535) - 302194..302739 (-) 546 WP_000040562.1 gp16 family protein -
  BBB50_RS01540 (BBB50_01540) - 302752..303021 (-) 270 WP_230078620.1 hypothetical protein -
  BBB50_RS01545 (BBB50_01545) - 303033..303266 (-) 234 WP_000466681.1 hypothetical protein -
  BBB50_RS01555 (BBB50_01555) - 303346..303876 (-) 531 WP_000762331.1 hypothetical protein -
  BBB50_RS01560 (BBB50_01560) - 303873..304142 (-) 270 WP_000856884.1 DUF3850 domain-containing protein -
  BBB50_RS20590 (BBB50_01565) - 304145..304495 (-) 351 WP_001066644.1 hypothetical protein -
  BBB50_RS01570 (BBB50_01570) - 304492..304689 (-) 198 WP_000413231.1 hypothetical protein -
  BBB50_RS01575 (BBB50_01575) - 304673..304915 (-) 243 WP_000551393.1 hypothetical protein -
  BBB50_RS01580 (BBB50_01580) - 304908..305180 (-) 273 WP_000512064.1 hypothetical protein -
  BBB50_RS01585 (BBB50_01585) - 305190..305804 (-) 615 WP_001192102.1 DUF3164 family protein -
  BBB50_RS01595 (BBB50_01595) - 305954..306328 (-) 375 WP_001032752.1 hypothetical protein -
  BBB50_RS01600 (BBB50_01600) - 306338..306907 (-) 570 WP_001216028.1 hypothetical protein -
  BBB50_RS01605 (BBB50_01605) - 306917..307141 (-) 225 WP_000157299.1 hypothetical protein -
  BBB50_RS01610 (BBB50_01610) - 307149..308093 (-) 945 WP_000800334.1 AAA family ATPase -
  BBB50_RS01615 (BBB50_01615) - 308120..310123 (-) 2004 WP_001895336.1 transposase domain-containing protein -
  BBB50_RS01620 (BBB50_01620) - 310135..310359 (-) 225 WP_000373567.1 helix-turn-helix domain-containing protein -
  BBB50_RS01625 (BBB50_01625) - 310512..311249 (+) 738 WP_000005494.1 LexA family transcriptional regulator -
  BBB50_RS01630 (BBB50_01630) pilM 311518..311997 (+) 480 Protein_293 type IV pilus assembly protein PilM -
  BBB50_RS01635 (BBB50_01635) pilN 311987..312571 (+) 585 WP_000902745.1 PilN domain-containing protein Machinery gene
  BBB50_RS01640 (BBB50_01640) pilO 312564..313154 (+) 591 WP_000157690.1 type 4a pilus biogenesis protein PilO Machinery gene
  BBB50_RS01645 (BBB50_01645) pilP 313144..313662 (+) 519 WP_000792032.1 pilus assembly protein PilP Machinery gene
  BBB50_RS01650 (BBB50_01650) pilQ 313688..315403 (+) 1716 WP_000788426.1 type IV pilus secretin PilQ Machinery gene

Sequence


Protein


Download         Length: 194 a.a.        Molecular weight: 21964.42 Da        Isoelectric Point: 9.9503

>NTDB_id=186913 BBB50_RS01635 WP_000902745.1 311987..312571(+) (pilN) [Vibrio cholerae 2740-80]
MLHKVNLLPWRDARREAHKRRFLGLVTLGVLLAVLMQFAAGEYLGGQMALQQERIGYLQQHIFSLDQQIAKLKIAEEEHK
ALLTRLTVVEQLQQKRNKTTEFMNQMPNLIPEGVYVDKIKMNGHQIEITGISDSTARLATMLDNLEKSDKLTDVEMHEIV
SGNKRFGKQFQSFKVSFQILTPASNPQAGGAHNG

Nucleotide


Download         Length: 585 bp        

>NTDB_id=186913 BBB50_RS01635 WP_000902745.1 311987..312571(+) (pilN) [Vibrio cholerae 2740-80]
ATGTTGCATAAGGTCAACTTACTGCCGTGGCGTGATGCACGGCGTGAAGCACATAAGCGGCGCTTTTTGGGGTTAGTGAC
ACTCGGTGTTTTGCTGGCGGTGTTGATGCAATTTGCAGCAGGCGAATACTTGGGCGGACAAATGGCTTTGCAACAAGAGC
GGATTGGTTATTTGCAACAACATATCTTCTCGCTGGATCAGCAGATCGCTAAGTTGAAGATCGCTGAAGAAGAACATAAG
GCGTTATTGACCCGTTTGACTGTGGTGGAGCAACTGCAGCAAAAGCGCAATAAAACGACTGAGTTTATGAACCAAATGCC
CAACCTGATCCCTGAAGGCGTCTATGTCGACAAGATCAAGATGAATGGCCATCAGATAGAAATAACCGGGATTAGCGATT
CCACCGCTCGCTTGGCAACCATGCTCGATAACTTGGAGAAGTCGGACAAATTAACCGATGTTGAAATGCATGAAATCGTT
TCAGGGAATAAGCGATTTGGTAAGCAATTTCAGAGCTTTAAAGTCTCCTTCCAAATTTTAACCCCAGCCTCTAACCCGCA
AGCGGGAGGTGCACACAATGGCTAG

Domains


Predicted by InterproScan.

(102-178)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H6BVQ2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilN Vibrio cholerae strain A1552

100

100

1

  pilN Vibrio campbellii strain DS40M4

60.452

91.237

0.552


Multiple sequence alignment