Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   A8O17_RS15390 Genome accession   NZ_CP015975
Coordinates   2918404..2918544 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain delta6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2913404..2923544
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A8O17_RS15365 (A8O17_15365) yuxO 2913717..2914097 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  A8O17_RS15370 (A8O17_15370) comA 2914116..2914760 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  A8O17_RS15375 (A8O17_15375) comP 2914841..2917150 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  A8O17_RS15380 (A8O17_15380) comX 2917165..2917332 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  A8O17_RS15385 (A8O17_15385) comQ 2917320..2918219 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  A8O17_RS15390 (A8O17_15390) degQ 2918404..2918544 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  A8O17_RS20985 - 2918766..2918891 (+) 126 WP_003228793.1 hypothetical protein -
  A8O17_RS15395 (A8O17_15395) - 2919005..2919373 (+) 369 WP_003243784.1 hypothetical protein -
  A8O17_RS15400 (A8O17_15400) pdeH 2919349..2920578 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  A8O17_RS15405 (A8O17_15405) pncB 2920715..2922187 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  A8O17_RS15410 (A8O17_15410) pncA 2922203..2922754 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  A8O17_RS15415 (A8O17_15415) yueI 2922851..2923249 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=184911 A8O17_RS15390 WP_003220708.1 2918404..2918544(-) (degQ) [Bacillus subtilis subsp. subtilis strain delta6]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=184911 A8O17_RS15390 WP_003220708.1 2918404..2918544(-) (degQ) [Bacillus subtilis subsp. subtilis strain delta6]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment