Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   B4U62_RS17145 Genome accession   NZ_CP020102
Coordinates   3255868..3256035 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis strain NCIB 3610     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250868..3261035
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B4U62_RS17115 (B4U62_17115) mrpE 3251263..3251739 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  B4U62_RS17120 (B4U62_17120) mrpF 3251739..3252023 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  B4U62_RS17125 (B4U62_17125) mnhG 3252007..3252381 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  B4U62_RS17130 (B4U62_17130) yuxO 3252420..3252800 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  B4U62_RS17135 (B4U62_17135) comA 3252819..3253463 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  B4U62_RS17140 (B4U62_17140) comP 3253544..3255853 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  B4U62_RS17145 (B4U62_17145) comX 3255868..3256035 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  B4U62_RS17150 (B4U62_17150) comQ 3256023..3256922 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  B4U62_RS17155 (B4U62_17155) degQ 3257107..3257247 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  B4U62_RS22935 - 3257469..3257594 (+) 126 WP_003228793.1 hypothetical protein -
  B4U62_RS17160 (B4U62_17160) - 3257708..3258076 (+) 369 WP_003243784.1 hypothetical protein -
  B4U62_RS17165 (B4U62_17165) pdeH 3258052..3259281 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  B4U62_RS17170 (B4U62_17170) pncB 3259418..3260890 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=184902 B4U62_RS17145 WP_003242801.1 3255868..3256035(-) (comX) [Bacillus subtilis strain NCIB 3610]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=184902 B4U62_RS17145 WP_003242801.1 3255868..3256035(-) (comX) [Bacillus subtilis strain NCIB 3610]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment