Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   B4U62_RS17155 Genome accession   NZ_CP020102
Coordinates   3257107..3257247 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain NCIB 3610     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3252107..3262247
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B4U62_RS17130 (B4U62_17130) yuxO 3252420..3252800 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  B4U62_RS17135 (B4U62_17135) comA 3252819..3253463 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  B4U62_RS17140 (B4U62_17140) comP 3253544..3255853 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  B4U62_RS17145 (B4U62_17145) comX 3255868..3256035 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  B4U62_RS17150 (B4U62_17150) comQ 3256023..3256922 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  B4U62_RS17155 (B4U62_17155) degQ 3257107..3257247 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  B4U62_RS22935 - 3257469..3257594 (+) 126 WP_003228793.1 hypothetical protein -
  B4U62_RS17160 (B4U62_17160) - 3257708..3258076 (+) 369 WP_003243784.1 hypothetical protein -
  B4U62_RS17165 (B4U62_17165) pdeH 3258052..3259281 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  B4U62_RS17170 (B4U62_17170) pncB 3259418..3260890 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  B4U62_RS17175 (B4U62_17175) pncA 3260906..3261457 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  B4U62_RS17180 (B4U62_17180) yueI 3261554..3261952 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=184904 B4U62_RS17155 WP_003220708.1 3257107..3257247(-) (degQ) [Bacillus subtilis strain NCIB 3610]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=184904 B4U62_RS17155 WP_003220708.1 3257107..3257247(-) (degQ) [Bacillus subtilis strain NCIB 3610]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1