Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   A8O17_RS11900 Genome accession   NZ_CP015975
Coordinates   2262539..2262913 (-) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis subsp. subtilis strain delta6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2257539..2267913
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A8O17_RS11860 (A8O17_11860) yqhG 2257871..2258665 (+) 795 WP_003230200.1 YqhG family protein -
  A8O17_RS11865 (A8O17_11865) sinI 2258848..2259021 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  A8O17_RS11870 (A8O17_11870) sinR 2259055..2259390 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  A8O17_RS11875 (A8O17_11875) tasA 2259483..2260268 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  A8O17_RS11880 (A8O17_11880) sipW 2260332..2260904 (-) 573 WP_003246088.1 signal peptidase I SipW -
  A8O17_RS11885 (A8O17_11885) tapA 2260888..2261649 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  A8O17_RS11890 (A8O17_11890) yqzG 2261921..2262247 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  A8O17_RS11895 (A8O17_11895) spoIITA 2262289..2262468 (-) 180 WP_003230176.1 YqzE family protein -
  A8O17_RS11900 (A8O17_11900) comGG 2262539..2262913 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  A8O17_RS11905 (A8O17_11905) comGF 2262914..2263297 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  A8O17_RS11910 (A8O17_11910) comGE 2263323..2263670 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  A8O17_RS11915 (A8O17_11915) comGD 2263654..2264085 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  A8O17_RS11920 (A8O17_11920) comGC 2264075..2264371 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  A8O17_RS11925 (A8O17_11925) comGB 2264385..2265422 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  A8O17_RS11930 (A8O17_11930) comGA 2265409..2266479 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  A8O17_RS11940 (A8O17_11940) corA 2266891..2267844 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=184887 A8O17_RS11900 WP_003230170.1 2262539..2262913(-) (comGG) [Bacillus subtilis subsp. subtilis strain delta6]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=184887 A8O17_RS11900 WP_003230170.1 2262539..2262913(-) (comGG) [Bacillus subtilis subsp. subtilis strain delta6]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment