Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | A8O17_RS11865 | Genome accession | NZ_CP015975 |
| Coordinates | 2258848..2259021 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain delta6 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2253848..2264021
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A8O17_RS11850 (A8O17_11850) | gcvT | 2254647..2255735 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| A8O17_RS11855 (A8O17_11855) | hepAA | 2256177..2257850 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| A8O17_RS11860 (A8O17_11860) | yqhG | 2257871..2258665 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| A8O17_RS11865 (A8O17_11865) | sinI | 2258848..2259021 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| A8O17_RS11870 (A8O17_11870) | sinR | 2259055..2259390 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| A8O17_RS11875 (A8O17_11875) | tasA | 2259483..2260268 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| A8O17_RS11880 (A8O17_11880) | sipW | 2260332..2260904 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| A8O17_RS11885 (A8O17_11885) | tapA | 2260888..2261649 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| A8O17_RS11890 (A8O17_11890) | yqzG | 2261921..2262247 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| A8O17_RS11895 (A8O17_11895) | spoIITA | 2262289..2262468 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| A8O17_RS11900 (A8O17_11900) | comGG | 2262539..2262913 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| A8O17_RS11905 (A8O17_11905) | comGF | 2262914..2263297 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| A8O17_RS11910 (A8O17_11910) | comGE | 2263323..2263670 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=184885 A8O17_RS11865 WP_003230187.1 2258848..2259021(+) (sinI) [Bacillus subtilis subsp. subtilis strain delta6]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=184885 A8O17_RS11865 WP_003230187.1 2258848..2259021(+) (sinI) [Bacillus subtilis subsp. subtilis strain delta6]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |