Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BSA171_RS04885 Genome accession   NZ_CP015611
Coordinates   970838..970978 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain U17-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 965838..975978
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSA171_RS04860 (BSA171_04795) - 966068..966475 (+) 408 WP_041088459.1 YueI family protein -
  BSA171_RS04865 (BSA171_04800) - 966535..967086 (+) 552 WP_024425949.1 cysteine hydrolase family protein -
  BSA171_RS04870 (BSA171_04805) - 967104..968576 (+) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  BSA171_RS04875 (BSA171_04810) - 968714..969940 (+) 1227 WP_075611856.1 EAL and HDOD domain-containing protein -
  BSA171_RS04880 (BSA171_04815) - 969976..970332 (-) 357 WP_041088463.1 hypothetical protein -
  BSA171_RS04885 (BSA171_04820) degQ 970838..970978 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  BSA171_RS04890 (BSA171_04825) - 971130..972044 (+) 915 WP_075611855.1 polyprenyl synthetase family protein -
  BSA171_RS04895 comX 972041..972211 (+) 171 WP_075611854.1 competence pheromone ComX -
  BSA171_RS04900 (BSA171_04830) comP 972266..974578 (+) 2313 WP_075611853.1 ATP-binding protein Regulator
  BSA171_RS04905 (BSA171_04835) comA 974659..975300 (+) 642 WP_024423322.1 response regulator transcription factor Regulator
  BSA171_RS04910 (BSA171_04840) - 975324..975713 (+) 390 WP_041088470.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=181433 BSA171_RS04885 WP_003213123.1 970838..970978(+) (degQ) [Bacillus safensis strain U17-1]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=181433 BSA171_RS04885 WP_003213123.1 970838..970978(+) (degQ) [Bacillus safensis strain U17-1]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment