Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BSA145_RS05845 | Genome accession | NZ_CP015607 |
| Coordinates | 1103820..1103960 (+) | Length | 46 a.a. |
| NCBI ID | WP_003213123.1 | Uniprot ID | A0A5K1N966 |
| Organism | Bacillus safensis strain U14-5 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1098820..1108960
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSA145_RS05820 (BSA145_05710) | - | 1099049..1099456 (+) | 408 | WP_075621892.1 | YueI family protein | - |
| BSA145_RS05825 (BSA145_05715) | - | 1099517..1100068 (+) | 552 | WP_024425949.1 | cysteine hydrolase family protein | - |
| BSA145_RS05830 (BSA145_05720) | - | 1100086..1101558 (+) | 1473 | WP_024423327.1 | nicotinate phosphoribosyltransferase | - |
| BSA145_RS05835 (BSA145_05725) | - | 1101696..1102922 (+) | 1227 | WP_075621893.1 | EAL and HDOD domain-containing protein | - |
| BSA145_RS05840 (BSA145_05730) | - | 1102958..1103314 (-) | 357 | WP_081385844.1 | inner spore coat protein | - |
| BSA145_RS05845 (BSA145_05735) | degQ | 1103820..1103960 (+) | 141 | WP_003213123.1 | degradation enzyme regulation protein DegQ | Regulator |
| BSA145_RS05850 (BSA145_05740) | - | 1104112..1105035 (+) | 924 | WP_075621894.1 | polyprenyl synthetase family protein | - |
| BSA145_RS05855 (BSA145_05745) | comX | 1105013..1105186 (+) | 174 | WP_041107629.1 | competence pheromone ComX | - |
| BSA145_RS05860 (BSA145_05750) | comP | 1105200..1107491 (+) | 2292 | WP_075621895.1 | ATP-binding protein | Regulator |
| BSA145_RS05865 (BSA145_05755) | comA | 1107572..1108213 (+) | 642 | WP_024423322.1 | response regulator transcription factor | Regulator |
| BSA145_RS05870 (BSA145_05760) | - | 1108237..1108626 (+) | 390 | WP_075621896.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5677.42 Da Isoelectric Point: 4.6828
>NTDB_id=181315 BSA145_RS05845 WP_003213123.1 1103820..1103960(+) (degQ) [Bacillus safensis strain U14-5]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=181315 BSA145_RS05845 WP_003213123.1 1103820..1103960(+) (degQ) [Bacillus safensis strain U14-5]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
68.085 |
100 |
0.696 |