Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   A4W74_RS03695 Genome accession   NZ_CP015494
Coordinates   717377..717685 (+) Length   102 a.a.
NCBI ID   WP_004270901.1    Uniprot ID   A0AAJ0LFY3
Organism   Latilactobacillus curvatus strain TMW 1.1390     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 712377..722685
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A4W74_RS03655 (A4W74_03635) - 712659..712898 (-) 240 WP_004270892.1 cytochrome b5 domain-containing protein -
  A4W74_RS03660 (A4W74_03640) - 713093..713428 (+) 336 WP_136903898.1 hypothetical protein -
  A4W74_RS03670 (A4W74_03650) - 713609..713986 (-) 378 WP_111447553.1 hypothetical protein -
  A4W74_RS03675 (A4W74_03655) - 714089..714589 (+) 501 WP_004270893.1 VanZ family protein -
  A4W74_RS03680 (A4W74_03660) - 714679..715410 (+) 732 WP_004270897.1 YebC/PmpR family DNA-binding transcriptional regulator -
  A4W74_RS03685 (A4W74_03665) comGA 715514..716389 (+) 876 WP_111447555.1 competence type IV pilus ATPase ComGA Machinery gene
  A4W74_RS03690 (A4W74_03670) comGB 716379..717380 (+) 1002 WP_004270906.1 type II secretion system F family protein Machinery gene
  A4W74_RS03695 (A4W74_03675) comGC 717377..717685 (+) 309 WP_004270901.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  A4W74_RS03700 (A4W74_03680) - 717717..718109 (+) 393 WP_004270899.1 hypothetical protein -
  A4W74_RS03705 (A4W74_03685) - 718096..718401 (+) 306 WP_035186736.1 hypothetical protein -
  A4W74_RS10420 - 718367..718450 (+) 84 Protein_712 prepilin-type N-terminal cleavage/methylation domain-containing protein -
  A4W74_RS03710 (A4W74_03690) - 718472..718852 (+) 381 WP_004270914.1 ComGF family competence protein -
  A4W74_RS03715 (A4W74_03695) - 718830..719153 (+) 324 WP_039099486.1 hypothetical protein -
  A4W74_RS03720 (A4W74_03700) - 719269..720288 (+) 1020 WP_253733850.1 class I SAM-dependent methyltransferase -
  A4W74_RS03725 (A4W74_03705) - 720310..721503 (+) 1194 WP_253733851.1 acetate kinase -
  A4W74_RS03730 (A4W74_03710) - 721563..722015 (+) 453 WP_056967146.1 hypothetical protein -

Sequence


Protein


Download         Length: 102 a.a.        Molecular weight: 11238.13 Da        Isoelectric Point: 9.6264

>NTDB_id=180048 A4W74_RS03695 WP_004270901.1 717377..717685(+) (comGC) [Latilactobacillus curvatus strain TMW 1.1390]
MKKKRNAFTLIEMVVVLAVIAMLVLLIAPNLMHQKETAEQKTDTALVATIQTQVELAEDDGKTVSSLADLASGEKYLTNN
QVKQAEKRGITIKDNKVVQNTK

Nucleotide


Download         Length: 309 bp        

>NTDB_id=180048 A4W74_RS03695 WP_004270901.1 717377..717685(+) (comGC) [Latilactobacillus curvatus strain TMW 1.1390]
ATGAAGAAGAAAAGAAATGCATTTACATTGATCGAAATGGTCGTTGTGCTAGCTGTGATAGCAATGTTAGTCTTGTTAAT
TGCACCTAATTTAATGCATCAGAAAGAGACAGCTGAGCAAAAAACGGATACGGCTCTAGTGGCAACGATTCAAACACAAG
TTGAATTAGCTGAGGATGACGGTAAAACGGTGTCGAGTCTAGCCGATTTAGCATCAGGTGAAAAATATTTAACCAATAAT
CAGGTTAAACAAGCTGAAAAACGCGGCATAACAATTAAGGATAATAAAGTTGTTCAAAATACAAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

60

98.039

0.588


Multiple sequence alignment