Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   A1D33_RS07280 Genome accession   NZ_CP015443
Coordinates   1592915..1593034 (-) Length   39 a.a.
NCBI ID   WP_031378677.1    Uniprot ID   -
Organism   Bacillus velezensis strain CC09     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1587915..1598034
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A1D33_RS07260 (A1D33_007265) - 1588156..1588914 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  A1D33_RS07265 (A1D33_007270) - 1588908..1589855 (-) 948 WP_040238557.1 iron chelate uptake ABC transporter family permease subunit -
  A1D33_RS07270 (A1D33_007275) ceuB 1589845..1590798 (-) 954 WP_015239156.1 ABC transporter permease Machinery gene
  A1D33_RS07275 (A1D33_007280) - 1591212..1592576 (+) 1365 WP_042634827.1 aspartate kinase -
  A1D33_RS20420 - 1592656..1592766 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  A1D33_RS07280 (A1D33_007285) phrC 1592915..1593034 (-) 120 WP_031378677.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  A1D33_RS07285 (A1D33_007290) rapC 1593018..1594166 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  A1D33_RS07290 (A1D33_007295) - 1594308..1595741 (-) 1434 WP_162303988.1 sensor histidine kinase -
  A1D33_RS07295 (A1D33_007300) - 1595728..1596411 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4240.97 Da        Isoelectric Point: 8.0284

>NTDB_id=179838 A1D33_RS07280 WP_031378677.1 1592915..1593034(-) (phrC) [Bacillus velezensis strain CC09]
MKLKSKWFVICLAAAAIFTVTGAGQPDQADFHVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=179838 A1D33_RS07280 WP_031378677.1 1592915..1593034(-) (phrC) [Bacillus velezensis strain CC09]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGCCAGA
TCAGGCTGACTTCCATGTAACTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769


Multiple sequence alignment