Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | Bt4C1_RS12035 | Genome accession | NZ_CP015176 |
| Coordinates | 2335633..2335914 (+) | Length | 93 a.a. |
| NCBI ID | WP_063675347.1 | Uniprot ID | - |
| Organism | Bacillus thuringiensis serovar alesti strain BGSC 4C1 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2334020..2389541 | 2335633..2335914 | within | 0 |
Gene organization within MGE regions
Location: 2334020..2389541
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Bt4C1_RS12020 (Bt4C1_12025) | - | 2334765..2334911 (+) | 147 | WP_000790088.1 | BC1881 family protein | - |
| Bt4C1_RS12025 (Bt4C1_12030) | - | 2335037..2335231 (+) | 195 | WP_042597799.1 | hypothetical protein | - |
| Bt4C1_RS12030 (Bt4C1_12035) | - | 2335256..2335636 (+) | 381 | WP_063675346.1 | hypothetical protein | - |
| Bt4C1_RS12035 (Bt4C1_12040) | abrB | 2335633..2335914 (+) | 282 | WP_063675347.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| Bt4C1_RS12040 (Bt4C1_12045) | - | 2335916..2336113 (+) | 198 | WP_042597805.1 | hypothetical protein | - |
| Bt4C1_RS12050 (Bt4C1_12055) | - | 2336337..2336567 (+) | 231 | WP_063676328.1 | hypothetical protein | - |
| Bt4C1_RS12055 (Bt4C1_12060) | - | 2336567..2337094 (+) | 528 | WP_063675348.1 | hypothetical protein | - |
| Bt4C1_RS12065 (Bt4C1_12070) | - | 2337262..2337612 (+) | 351 | WP_063675349.1 | hypothetical protein | - |
| Bt4C1_RS12070 (Bt4C1_12075) | - | 2337849..2338229 (+) | 381 | WP_063675350.1 | hypothetical protein | - |
| Bt4C1_RS12075 (Bt4C1_12080) | - | 2338636..2339199 (+) | 564 | WP_025118128.1 | recombinase family protein | - |
| Bt4C1_RS12080 (Bt4C1_12085) | - | 2339397..2339825 (+) | 429 | WP_001086032.1 | phBC6A51 family helix-turn-helix protein | - |
| Bt4C1_RS12085 (Bt4C1_12090) | terL | 2339842..2341557 (+) | 1716 | WP_063675351.1 | phage terminase large subunit | - |
| Bt4C1_RS12090 (Bt4C1_12095) | - | 2341574..2343091 (+) | 1518 | WP_063675352.1 | phage portal protein | - |
| Bt4C1_RS12095 (Bt4C1_12100) | - | 2343165..2343935 (+) | 771 | WP_238328425.1 | phage scaffolding protein | - |
| Bt4C1_RS12100 (Bt4C1_12105) | - | 2343996..2345120 (+) | 1125 | WP_063675354.1 | DUF5309 family protein | - |
| Bt4C1_RS12105 (Bt4C1_12110) | - | 2345170..2345394 (+) | 225 | WP_063675355.1 | head fiber protein | - |
| Bt4C1_RS12110 (Bt4C1_12115) | - | 2345423..2345764 (+) | 342 | WP_063675356.1 | hypothetical protein | - |
| Bt4C1_RS12115 (Bt4C1_12120) | - | 2345769..2346575 (+) | 807 | WP_033698994.1 | hypothetical protein | - |
| Bt4C1_RS12120 (Bt4C1_12125) | - | 2346579..2346953 (+) | 375 | WP_033698996.1 | hypothetical protein | - |
| Bt4C1_RS12125 (Bt4C1_12130) | - | 2346953..2347312 (+) | 360 | WP_033698998.1 | hypothetical protein | - |
| Bt4C1_RS12130 (Bt4C1_12135) | - | 2347315..2347722 (+) | 408 | WP_033699000.1 | hypothetical protein | - |
| Bt4C1_RS12135 (Bt4C1_12140) | - | 2347736..2348239 (+) | 504 | WP_063675357.1 | phage major tail protein, TP901-1 family | - |
| Bt4C1_RS12140 (Bt4C1_12145) | - | 2348290..2348502 (+) | 213 | WP_053513156.1 | hypothetical protein | - |
| Bt4C1_RS12145 (Bt4C1_12150) | - | 2348499..2348717 (+) | 219 | WP_063675358.1 | hypothetical protein | - |
| Bt4C1_RS12150 (Bt4C1_12155) | - | 2348788..2349165 (+) | 378 | WP_000818630.1 | tail assembly chaperone | - |
| Bt4C1_RS12155 (Bt4C1_12160) | - | 2349255..2349509 (+) | 255 | WP_000931846.1 | hypothetical protein | - |
| Bt4C1_RS12160 (Bt4C1_12165) | - | 2349519..2353442 (+) | 3924 | WP_238328426.1 | phage tail tape measure protein | - |
| Bt4C1_RS12165 (Bt4C1_12170) | - | 2353457..2354953 (+) | 1497 | WP_063675359.1 | distal tail protein Dit | - |
| Bt4C1_RS12170 (Bt4C1_12175) | - | 2354950..2359572 (+) | 4623 | WP_081252864.1 | phage tail spike protein | - |
| Bt4C1_RS12175 (Bt4C1_12180) | - | 2359615..2359851 (+) | 237 | WP_016081457.1 | hemolysin XhlA family protein | - |
| Bt4C1_RS12180 (Bt4C1_12185) | - | 2359851..2360090 (+) | 240 | WP_063675360.1 | hypothetical protein | - |
| Bt4C1_RS12185 (Bt4C1_12190) | - | 2360087..2361151 (+) | 1065 | WP_063675361.1 | N-acetylmuramoyl-L-alanine amidase | - |
| Bt4C1_RS12190 (Bt4C1_12195) | - | 2361213..2362235 (-) | 1023 | WP_238328427.1 | zinc-ribbon domain-containing protein | - |
| Bt4C1_RS12195 (Bt4C1_12200) | - | 2362232..2362558 (-) | 327 | WP_063675362.1 | hypothetical protein | - |
| Bt4C1_RS12200 (Bt4C1_12205) | - | 2362622..2362951 (-) | 330 | WP_063675363.1 | hypothetical protein | - |
| Bt4C1_RS12205 (Bt4C1_12210) | - | 2363028..2363267 (-) | 240 | WP_000097410.1 | helix-turn-helix transcriptional regulator | - |
| Bt4C1_RS31395 | - | 2363449..2363571 (+) | 123 | WP_142286838.1 | DUF3961 domain-containing protein | - |
| Bt4C1_RS12210 (Bt4C1_12215) | - | 2364215..2364415 (-) | 201 | WP_061884062.1 | helix-turn-helix transcriptional regulator | - |
| Bt4C1_RS12215 (Bt4C1_12220) | - | 2364601..2364870 (+) | 270 | WP_033699018.1 | hypothetical protein | - |
| Bt4C1_RS12220 (Bt4C1_12225) | - | 2364867..2365169 (+) | 303 | WP_063675364.1 | hypothetical protein | - |
| Bt4C1_RS12225 (Bt4C1_12230) | - | 2365166..2365348 (+) | 183 | WP_000170792.1 | hypothetical protein | - |
| Bt4C1_RS12230 (Bt4C1_12235) | - | 2365464..2366648 (+) | 1185 | WP_063675365.1 | FtsK/SpoIIIE domain-containing protein | - |
| Bt4C1_RS12235 (Bt4C1_12240) | - | 2366590..2367210 (+) | 621 | WP_033699025.1 | replication-relaxation family protein | - |
| Bt4C1_RS32490 | - | 2367243..2367365 (+) | 123 | WP_275895176.1 | hypothetical protein | - |
| Bt4C1_RS12240 (Bt4C1_12245) | - | 2367700..2369163 (+) | 1464 | WP_063676339.1 | recombinase family protein | - |
| Bt4C1_RS12245 (Bt4C1_12250) | - | 2369169..2369462 (-) | 294 | WP_050821864.1 | DUF1232 domain-containing protein | - |
| Bt4C1_RS12250 (Bt4C1_12255) | - | 2369709..2370395 (+) | 687 | WP_000691159.1 | MBL fold metallo-hydrolase | - |
| Bt4C1_RS12255 (Bt4C1_12260) | - | 2370555..2370869 (+) | 315 | WP_017763155.1 | hypothetical protein | - |
| Bt4C1_RS12260 (Bt4C1_12265) | - | 2370898..2372247 (+) | 1350 | WP_063675366.1 | DEAD/DEAH box helicase | - |
| Bt4C1_RS12265 (Bt4C1_12270) | - | 2372550..2373260 (+) | 711 | WP_063675367.1 | class I SAM-dependent methyltransferase | - |
| Bt4C1_RS12270 (Bt4C1_12275) | - | 2373379..2373786 (+) | 408 | WP_000072495.1 | VOC family protein | - |
| Bt4C1_RS12275 (Bt4C1_12280) | - | 2374130..2374909 (+) | 780 | WP_063675368.1 | class I SAM-dependent methyltransferase | - |
| Bt4C1_RS12280 (Bt4C1_12285) | - | 2375063..2375908 (-) | 846 | Protein_2426 | thiamine pyrophosphate-dependent enzyme | - |
| Bt4C1_RS30175 | - | 2375884..2376012 (-) | 129 | WP_003265031.1 | hypothetical protein | - |
| Bt4C1_RS12285 (Bt4C1_12290) | - | 2376160..2376642 (+) | 483 | WP_000191905.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| Bt4C1_RS12290 (Bt4C1_12295) | gpmA | 2376808..2377545 (+) | 738 | WP_000594159.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| Bt4C1_RS12295 (Bt4C1_12300) | - | 2377784..2378521 (+) | 738 | WP_000624981.1 | type II toxin-antitoxin system SpoIISA family toxin | - |
| Bt4C1_RS12300 (Bt4C1_12305) | - | 2378634..2378762 (+) | 129 | WP_000237817.1 | hypothetical protein | - |
| Bt4C1_RS12305 (Bt4C1_12310) | spoIISB | 2378835..2379011 (+) | 177 | WP_063675369.1 | stage II sporulation protein SB | - |
| Bt4C1_RS12310 (Bt4C1_12315) | - | 2379030..2379419 (-) | 390 | WP_000712655.1 | YxeA family protein | - |
| Bt4C1_RS12315 (Bt4C1_12320) | pepD | 2379631..2381100 (+) | 1470 | WP_000287541.1 | beta-Ala-His dipeptidase | - |
| Bt4C1_RS12320 (Bt4C1_12325) | - | 2381413..2382222 (+) | 810 | WP_000678376.1 | papain-like cysteine protease family protein | - |
| Bt4C1_RS12325 (Bt4C1_12330) | - | 2382248..2382853 (+) | 606 | WP_000527414.1 | hypothetical protein | - |
| Bt4C1_RS12330 (Bt4C1_12335) | - | 2382994..2383245 (-) | 252 | WP_063675370.1 | helix-turn-helix transcriptional regulator | - |
| Bt4C1_RS12335 (Bt4C1_12340) | - | 2383623..2384501 (+) | 879 | WP_063675371.1 | helix-turn-helix domain-containing protein | - |
| Bt4C1_RS12340 (Bt4C1_12345) | abrB | 2384642..2384920 (+) | 279 | WP_000842214.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| Bt4C1_RS12345 (Bt4C1_12350) | - | 2385532..2386782 (+) | 1251 | WP_001032355.1 | hypothetical protein | - |
| Bt4C1_RS12350 (Bt4C1_12355) | - | 2386850..2387608 (+) | 759 | WP_000347991.1 | TSUP family transporter | - |
| Bt4C1_RS12355 (Bt4C1_12360) | - | 2387861..2388520 (+) | 660 | WP_000682536.1 | CatB-related O-acetyltransferase | - |
Sequence
Protein
Download Length: 93 a.a. Molecular weight: 10256.84 Da Isoelectric Point: 4.4929
>NTDB_id=177311 Bt4C1_RS12035 WP_063675347.1 2335633..2335914(+) (abrB) [Bacillus thuringiensis serovar alesti strain BGSC 4C1]
MKSTGIIRNIDPLGRIVVPMELRRTLGIQEKDPMEIFVDGESIILQKYNPNGSCQITGEVSDENIELAGGKLVLSPEGID
QILVEIESHLKGR
MKSTGIIRNIDPLGRIVVPMELRRTLGIQEKDPMEIFVDGESIILQKYNPNGSCQITGEVSDENIELAGGKLVLSPEGID
QILVEIESHLKGR
Nucleotide
Download Length: 282 bp
>NTDB_id=177311 Bt4C1_RS12035 WP_063675347.1 2335633..2335914(+) (abrB) [Bacillus thuringiensis serovar alesti strain BGSC 4C1]
ATGAAATCAACAGGTATCATTCGTAACATCGACCCACTAGGACGAATTGTAGTTCCAATGGAATTACGTCGTACATTAGG
TATTCAGGAAAAGGATCCAATGGAGATTTTCGTAGATGGTGAATCTATTATTCTACAAAAATATAATCCAAATGGTTCTT
GCCAAATTACAGGTGAAGTTTCTGACGAAAATATTGAATTAGCCGGTGGGAAACTCGTGCTAAGTCCTGAGGGAATCGAC
CAAATTTTAGTGGAAATCGAATCACATTTGAAGGGGCGATAA
ATGAAATCAACAGGTATCATTCGTAACATCGACCCACTAGGACGAATTGTAGTTCCAATGGAATTACGTCGTACATTAGG
TATTCAGGAAAAGGATCCAATGGAGATTTTCGTAGATGGTGAATCTATTATTCTACAAAAATATAATCCAAATGGTTCTT
GCCAAATTACAGGTGAAGTTTCTGACGAAAATATTGAATTAGCCGGTGGGAAACTCGTGCTAAGTCCTGAGGGAATCGAC
CAAATTTTAGTGGAAATCGAATCACATTTGAAGGGGCGATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
67.033 |
97.849 |
0.656 |