Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/comC1   Type   Regulator
Locus tag   BTR42_RS12705 Genome accession   NZ_CP018822
Coordinates   2217529..2217669 (+) Length   46 a.a.
NCBI ID   WP_014295304.1    Uniprot ID   A0A1C3SR64
Organism   Streptococcus gallolyticus subsp. gallolyticus DSM 16831     
Function   binding to ComD; induce autophosphorylation of ComD (predicted from homology)   
Competence regulation

Genomic Context

Location: 2212529..2222669
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BTR42_RS11000 (BTR42_10740) - 2213071..2213271 (-) 201 WP_077497723.1 bacteriocin -
  BTR42_RS11005 (BTR42_10745) comD/comD3 2213404..2214768 (-) 1365 WP_077497726.1 sensor histidine kinase Regulator
  BTR42_RS11010 (BTR42_10750) comE/comE2 2214781..2215509 (-) 729 WP_012962512.1 LytR/AlgR family response regulator transcription factor Regulator
  BTR42_RS11015 (BTR42_10755) - 2215608..2215901 (-) 294 WP_009854994.1 bacteriocin immunity protein -
  BTR42_RS11020 (BTR42_10760) - 2215952..2216104 (-) 153 WP_231873055.1 hypothetical protein -
  BTR42_RS11025 (BTR42_10765) - 2216448..2216759 (-) 312 WP_003066564.1 bacteriocin immunity protein -
  BTR42_RS11030 (BTR42_10770) - 2216771..2216920 (-) 150 WP_013643483.1 hypothetical protein -
  BTR42_RS11035 (BTR42_10775) - 2216977..2217228 (-) 252 WP_231844599.1 DUF3884 family protein -
  BTR42_RS12705 (BTR42_10780) comC/comC1 2217529..2217669 (+) 141 WP_014295304.1 hypothetical protein Regulator
  BTR42_RS11040 (BTR42_10785) comD/comD1 2217686..2218996 (-) 1311 WP_058621373.1 sensor histidine kinase Regulator
  BTR42_RS11045 (BTR42_10790) comE/comE1 2219001..2219732 (-) 732 WP_077497729.1 response regulator transcription factor Regulator
  BTR42_RS11050 (BTR42_10795) - 2219749..2220075 (-) 327 WP_009855002.1 LytTR family DNA-binding domain-containing protein -
  BTR42_RS11055 (BTR42_10800) - 2220259..2221551 (-) 1293 WP_013643489.1 glycosyltransferase family 2 protein -
  BTR42_RS11060 (BTR42_10805) - 2221553..2221852 (-) 300 WP_013643490.1 DUF3884 family protein -
  BTR42_RS11065 (BTR42_10810) - 2221878..2222060 (-) 183 WP_013643491.1 hypothetical protein -
  BTR42_RS11070 (BTR42_10815) - 2222142..2222351 (-) 210 WP_013643492.1 helix-turn-helix domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5471.41 Da        Isoelectric Point: 10.2565

>NTDB_id=176256 BTR42_RS12705 WP_014295304.1 2217529..2217669(+) (comC/comC1) [Streptococcus gallolyticus subsp. gallolyticus DSM 16831]
MMTEKMFKELNQSELEKTIGGKNKDFLIVGPFDWFKKHQGKSQKHM

Nucleotide


Download         Length: 141 bp        

>NTDB_id=176256 BTR42_RS12705 WP_014295304.1 2217529..2217669(+) (comC/comC1) [Streptococcus gallolyticus subsp. gallolyticus DSM 16831]
ATGATGACAGAAAAAATGTTTAAAGAATTAAATCAATCTGAATTAGAGAAAACGATTGGTGGAAAGAATAAGGATTTCTT
AATTGTTGGACCTTTCGATTGGTTTAAAAAACATCAAGGGAAATCACAAAAACACATGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1C3SR64

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus equinus JB1

56.667

65.217

0.37