Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   A3772_RS13335 Genome accession   NZ_CP015004
Coordinates   2535742..2536116 (-) Length   124 a.a.
NCBI ID   WP_003230170.1    Uniprot ID   A0AAE2SIW8
Organism   Bacillus subtilis strain SZMC 6179J isolate B23     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2530742..2541116
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A3772_RS13295 (A3772_13295) yqhG 2531074..2531868 (+) 795 WP_003230200.1 YqhG family protein -
  A3772_RS13300 (A3772_13300) sinI 2532051..2532224 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  A3772_RS13305 (A3772_13305) sinR 2532258..2532593 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  A3772_RS13310 (A3772_13310) tasA 2532686..2533471 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  A3772_RS13315 (A3772_13315) sipW 2533535..2534107 (-) 573 WP_003246088.1 signal peptidase I SipW -
  A3772_RS13320 (A3772_13320) tapA 2534091..2534852 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  A3772_RS13325 (A3772_13325) yqzG 2535124..2535450 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  A3772_RS13330 (A3772_13330) spoIITA 2535492..2535671 (-) 180 WP_003230176.1 YqzE family protein -
  A3772_RS13335 (A3772_13335) comGG 2535742..2536116 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  A3772_RS13340 (A3772_13340) comGF 2536117..2536500 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  A3772_RS13345 (A3772_13345) comGE 2536526..2536873 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  A3772_RS13350 (A3772_13350) comGD 2536857..2537288 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  A3772_RS13355 (A3772_13355) comGC 2537278..2537574 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  A3772_RS13360 (A3772_13360) comGB 2537588..2538625 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  A3772_RS13365 (A3772_13365) comGA 2538612..2539682 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  A3772_RS13375 (A3772_13375) corA 2540094..2541047 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14539.79 Da        Isoelectric Point: 9.2806

>NTDB_id=176054 A3772_RS13335 WP_003230170.1 2535742..2536116(-) (comGG) [Bacillus subtilis strain SZMC 6179J isolate B23]
MYRTRGFIYPAVLFVSALVLLIVNFVAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFLYGRVS
YYIHDTSIKEQKEINLRVSTDSGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=176054 A3772_RS13335 WP_003230170.1 2535742..2536116(-) (comGG) [Bacillus subtilis strain SZMC 6179J isolate B23]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGTTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCTATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGATTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment