Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | A3772_RS13300 | Genome accession | NZ_CP015004 |
| Coordinates | 2532051..2532224 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis strain SZMC 6179J isolate B23 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2527051..2537224
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A3772_RS13285 (A3772_13285) | gcvT | 2527850..2528938 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| A3772_RS13290 (A3772_13290) | hepAA | 2529380..2531053 (+) | 1674 | WP_004398544.1 | DEAD/DEAH box helicase | - |
| A3772_RS13295 (A3772_13295) | yqhG | 2531074..2531868 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| A3772_RS13300 (A3772_13300) | sinI | 2532051..2532224 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| A3772_RS13305 (A3772_13305) | sinR | 2532258..2532593 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| A3772_RS13310 (A3772_13310) | tasA | 2532686..2533471 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| A3772_RS13315 (A3772_13315) | sipW | 2533535..2534107 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| A3772_RS13320 (A3772_13320) | tapA | 2534091..2534852 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| A3772_RS13325 (A3772_13325) | yqzG | 2535124..2535450 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| A3772_RS13330 (A3772_13330) | spoIITA | 2535492..2535671 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| A3772_RS13335 (A3772_13335) | comGG | 2535742..2536116 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| A3772_RS13340 (A3772_13340) | comGF | 2536117..2536500 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| A3772_RS13345 (A3772_13345) | comGE | 2536526..2536873 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=176052 A3772_RS13300 WP_003230187.1 2532051..2532224(+) (sinI) [Bacillus subtilis strain SZMC 6179J isolate B23]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=176052 A3772_RS13300 WP_003230187.1 2532051..2532224(+) (sinI) [Bacillus subtilis strain SZMC 6179J isolate B23]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |