Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   A2I97_RS01975 Genome accession   NZ_CP014990
Coordinates   384349..384468 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain KD1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 379349..389468
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A2I97_RS01960 (A2I97_01915) - 380961..381644 (+) 684 WP_070081359.1 response regulator transcription factor -
  A2I97_RS01965 (A2I97_01920) - 381631..383064 (+) 1434 WP_161941456.1 sensor histidine kinase -
  A2I97_RS01970 (A2I97_01925) rapC 383217..384365 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  A2I97_RS01975 (A2I97_01930) phrC 384349..384468 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  A2I97_RS01980 (A2I97_18975) - 384618..384728 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  A2I97_RS01985 (A2I97_01935) - 384808..386172 (-) 1365 WP_070081361.1 aspartate kinase -
  A2I97_RS01990 (A2I97_01940) ceuB 386587..387540 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  A2I97_RS01995 (A2I97_01945) - 387530..388477 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  A2I97_RS02000 (A2I97_01950) - 388471..389229 (+) 759 WP_022552588.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=175746 A2I97_RS01975 WP_003156334.1 384349..384468(+) (phrC) [Bacillus velezensis strain KD1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=175746 A2I97_RS01975 WP_003156334.1 384349..384468(+) (phrC) [Bacillus velezensis strain KD1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment