Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   B14_RS09120 Genome accession   NZ_CP014842
Coordinates   1766386..1766562 (-) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain SCDB 14     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1761386..1771562
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B14_RS09075 comGE 1761721..1762068 (+) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -
  B14_RS09080 (B14_01817) comGF 1762094..1762465 (+) 372 WP_003183461.1 competence type IV pilus minor pilin ComGF -
  B14_RS09085 (B14_01818) comGG 1762478..1762843 (+) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  B14_RS09090 (B14_01819) - 1762932..1763114 (+) 183 WP_003183456.1 YqzE family protein -
  B14_RS09095 (B14_01820) - 1763138..1763458 (-) 321 WP_003183454.1 YqzG/YhdC family protein -
  B14_RS09100 (B14_01821) tapA 1763735..1764463 (+) 729 WP_080623590.1 amyloid fiber anchoring/assembly protein TapA -
  B14_RS09105 (B14_01822) sipW 1764460..1765044 (+) 585 WP_003183449.1 signal peptidase I SipW -
  B14_RS09110 (B14_01823) tasA 1765118..1765912 (+) 795 WP_003183447.1 biofilm matrix protein TasA -
  B14_RS09115 (B14_01824) sinR 1766017..1766352 (-) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  B14_RS09120 (B14_01825) sinI 1766386..1766562 (-) 177 WP_003183444.1 anti-repressor SinI Regulator
  B14_RS09125 (B14_01826) - 1766753..1767547 (-) 795 WP_003183441.1 YqhG family protein -
  B14_RS09130 (B14_01827) - 1767554..1769233 (-) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  B14_RS09135 (B14_01828) gcvT 1769826..1770920 (+) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=174660 B14_RS09120 WP_003183444.1 1766386..1766562(-) (sinI) [Bacillus licheniformis strain SCDB 14]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=174660 B14_RS09120 WP_003183444.1 1766386..1766562(-) (sinI) [Bacillus licheniformis strain SCDB 14]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment