Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   B37_RS10755 Genome accession   NZ_CP014794
Coordinates   2044228..2044404 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus licheniformis strain SCCB 37     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2039228..2049404
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B37_RS10740 (B37_02175) gcvT 2039870..2040964 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  B37_RS10745 (B37_02176) - 2041557..2043236 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  B37_RS10750 (B37_02177) - 2043243..2044037 (+) 795 WP_003183441.1 YqhG family protein -
  B37_RS10755 (B37_02178) sinI 2044228..2044404 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  B37_RS10760 (B37_02179) sinR 2044438..2044773 (+) 336 WP_006637528.1 transcriptional regulator SinR Regulator
  B37_RS10765 (B37_02180) tasA 2044878..2045672 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  B37_RS10770 (B37_02181) sipW 2045746..2046330 (-) 585 WP_003183449.1 signal peptidase I SipW -
  B37_RS10775 (B37_02182) tapA 2046327..2047055 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  B37_RS10780 (B37_02183) - 2047332..2047652 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  B37_RS10785 (B37_02184) - 2047676..2047858 (-) 183 WP_003183456.1 YqzE family protein -
  B37_RS10790 (B37_02185) comGG 2047947..2048312 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  B37_RS10795 (B37_02186) comGF 2048325..2048813 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  B37_RS10800 comGE 2048722..2049069 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=174246 B37_RS10755 WP_003183444.1 2044228..2044404(+) (sinI) [Bacillus licheniformis strain SCCB 37]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=174246 B37_RS10755 WP_003183444.1 2044228..2044404(+) (sinI) [Bacillus licheniformis strain SCCB 37]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517


Multiple sequence alignment