Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   B34_RS09815 Genome accession   NZ_CP014793
Coordinates   1802991..1803131 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain SCDB 34     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1797991..1808131
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B34_RS09790 (B34_01981) - 1798262..1798651 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  B34_RS09795 (B34_01982) comA 1798668..1799306 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  B34_RS09800 (B34_01983) comP 1799393..1801714 (-) 2322 WP_026080865.1 ATP-binding protein Regulator
  B34_RS09805 (B34_01984) comX 1801754..1801918 (-) 165 WP_011198251.1 competence pheromone ComX -
  B34_RS09810 (B34_01985) - 1801933..1802802 (-) 870 WP_011198252.1 polyprenyl synthetase family protein -
  B34_RS09815 (B34_01986) degQ 1802991..1803131 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  B34_RS09825 (B34_01988) - 1803617..1803964 (+) 348 WP_009329512.1 hypothetical protein -
  B34_RS09830 (B34_01989) - 1804007..1805227 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  B34_RS09835 (B34_01990) - 1805406..1806815 (-) 1410 WP_228767691.1 nicotinate phosphoribosyltransferase -
  B34_RS09840 (B34_01991) - 1806893..1807444 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  B34_RS09845 (B34_01992) - 1807629..1808030 (-) 402 WP_003184870.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=174172 B34_RS09815 WP_003184860.1 1802991..1803131(-) (degQ) [Bacillus licheniformis strain SCDB 34]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=174172 B34_RS09815 WP_003184860.1 1802991..1803131(-) (degQ) [Bacillus licheniformis strain SCDB 34]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P69890

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment