Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   A1R12_RS14640 Genome accession   NZ_CP014783
Coordinates   3046077..3046217 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain B15     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3041077..3051217
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A1R12_RS14615 (A1R12_14615) - 3041374..3041757 (-) 384 WP_053574130.1 hotdog fold thioesterase -
  A1R12_RS14620 (A1R12_14620) comA 3041779..3042423 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  A1R12_RS14625 (A1R12_14625) comP 3042504..3044807 (-) 2304 WP_040238945.1 histidine kinase Regulator
  A1R12_RS14635 (A1R12_14635) comQ 3044960..3045946 (-) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  A1R12_RS14640 (A1R12_14640) degQ 3046077..3046217 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  A1R12_RS14645 (A1R12_14645) - 3046680..3047021 (+) 342 WP_015418107.1 hypothetical protein -
  A1R12_RS14650 (A1R12_14650) - 3047028..3048251 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  A1R12_RS14655 (A1R12_14655) - 3048381..3049847 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  A1R12_RS14660 (A1R12_14660) - 3049865..3050416 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  A1R12_RS14665 (A1R12_14665) - 3050513..3050911 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=173997 A1R12_RS14640 WP_003152043.1 3046077..3046217(-) (degQ) [Bacillus amyloliquefaciens strain B15]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=173997 A1R12_RS14640 WP_003152043.1 3046077..3046217(-) (degQ) [Bacillus amyloliquefaciens strain B15]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment