Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   A1R12_RS11715 Genome accession   NZ_CP014783
Coordinates   2484581..2485018 (-) Length   145 a.a.
NCBI ID   WP_043020787.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain B15     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2479581..2490018
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  A1R12_RS11665 (A1R12_11665) sinI 2479964..2480137 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  A1R12_RS11670 (A1R12_11670) sinR 2480171..2480506 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  A1R12_RS11675 (A1R12_11675) tasA 2480554..2481339 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  A1R12_RS11680 (A1R12_11680) sipW 2481404..2481988 (-) 585 WP_012117977.1 signal peptidase I SipW -
  A1R12_RS11685 (A1R12_11685) tapA 2481960..2482631 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  A1R12_RS11690 (A1R12_11690) - 2482890..2483219 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  A1R12_RS11695 (A1R12_11695) - 2483260..2483439 (-) 180 WP_003153093.1 YqzE family protein -
  A1R12_RS11700 (A1R12_11700) comGG 2483496..2483873 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  A1R12_RS11705 (A1R12_11705) comGF 2483874..2484374 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  A1R12_RS11710 (A1R12_11710) comGE 2484283..2484597 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  A1R12_RS11715 (A1R12_11715) comGD 2484581..2485018 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  A1R12_RS11720 (A1R12_11720) comGC 2485008..2485316 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  A1R12_RS11725 (A1R12_11725) comGB 2485321..2486358 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  A1R12_RS11730 (A1R12_11730) comGA 2486345..2487415 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  A1R12_RS11735 (A1R12_11735) - 2487608..2488558 (-) 951 WP_061890723.1 magnesium transporter CorA family protein -
  A1R12_RS11740 (A1R12_11740) - 2488704..2490005 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16271.77 Da        Isoelectric Point: 10.2475

>NTDB_id=173978 A1R12_RS11715 WP_043020787.1 2484581..2485018(-) (comGD) [Bacillus amyloliquefaciens strain B15]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTELLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=173978 A1R12_RS11715 WP_043020787.1 2484581..2485018(-) (comGD) [Bacillus amyloliquefaciens strain B15]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACTGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566


Multiple sequence alignment